KEGG   Mycobacterium smegmatis MC2 155: MSMEG_0127Help
Entry
MSMEG_0127        CDS       T00434                                 

Definition
(RefSeq) oxidoreductase, zinc-binding dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00010  Glycolysis / Gluconeogenesis
msm00071  Fatty acid degradation
msm00350  Tyrosine metabolism
msm00625  Chloroalkane and chloroalkene degradation
msm00626  Naphthalene degradation
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01120  Microbial metabolism in diverse environments
msm01130  Biosynthesis of antibiotics
msm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSMEG_0127
  Lipid metabolism
   00071 Fatty acid degradation
    MSMEG_0127
  Amino acid metabolism
   00350 Tyrosine metabolism
    MSMEG_0127
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MSMEG_0127
   00626 Naphthalene degradation
    MSMEG_0127
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MSMEG_0127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 Sacchrp_dh_NADP TrkA_N UDPG_MGDP_dh_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 4534581
NCBI-ProteinID: YP_884543
UniProt: A0QNQ5 I7F4P5
Position
complement(148387..149478)
Genome map
AA seq 363 aa AA seqDB search
MKIRGAVLERIGAPRPYAESRPLTISELDLADPGPDELLVRIESAGLCHSDLSVVDGNRV
RPVPMLLGHEAAGVVETPGADLETGQRVVMTFLPRCGSCPACGTDGLTPCGPGSVANGAG
TLMNGDIRLRRDGEPVFHHLGVSGFATHAVVDRRSIVPVPDDVPATVAALLGCAVLTGGG
AVLNVGRPKPGQTVVVVGLGGVGMAAALTALAHDDVRVVGVDQLSDKLARAAELGVHETF
TPEQAADLRAEVVIEAAGHPAALETAIGLTGPGGRTITVGLPRPDARITVSPLGFVAEGR
SLIGSYLGSAVPSRDIPRFVELWRAGRLPVESLVSSTIALDDINAGMDELAEGRAVRQVI
DFA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaagatccgcggagccgtcctcgaacgcatcggtgcaccccgtccctacgccgaatcc
cggccactgaccatctccgaactcgacctcgccgatccgggtccggatgaactgctggtg
cgcatcgagtccgccgggctgtgccactcggatctgtcggtcgtcgacggcaaccgggtg
cgtccggtgccgatgctgctggggcacgaggccgcgggtgtggtcgagacgccgggcgcg
gatctcgaaaccggtcagcgcgtggtgatgacgttcctgccgcgctgcggatcctgcccg
gcctgcgggaccgacgggctgaccccctgcgggccgggatcggtcgccaacggcgcgggc
acgctgatgaacggtgacatccggctgcgtcgcgacggcgaacctgtgttccaccacctc
ggtgtgtccgggttcgcgacgcacgccgtggtggaccgccgctcgatcgtgccggtaccc
gacgacgtgcccgcgacggtcgccgcgctgttgggttgcgcggtgctcacgggcggcggg
gccgtgctcaacgtcggccggccgaagccgggacagaccgtcgtggtcgtcggtctcggc
ggggtggggatggccgctgcgctcaccgcgctcgcgcacgacgacgtgcgggtggtcggt
gtcgaccagttgtccgacaagctggcccgcgcagccgaactcggcgtgcacgagaccttc
acccccgagcaggccgcggatctgcgggccgaggtggtgatcgaggccgcgggacatccg
gccgcgctggagaccgcgatcggtttgaccggtcctggcggacggaccatcacggtgggc
ctgccgcgccccgacgcgcggatcacggtgtcgccgttgggtttcgtcgccgaaggacgg
tctctgatcggcagttacctcggttcggcggtgccgtcgcgcgacatcccgcgtttcgtc
gagttgtggcgcgccgggcgcctgccggtggagtcgctcgtgtcgtcgaccatcgcgctc
gacgacatcaacgcgggcatggacgaactggccgagggccgtgcggtgcgtcaggtgatc
gacttcgcctga

DBGET integrated database retrieval system