KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_0403
Entry
MSMEG_0403        CDS       T00434                                 

Name
(GenBank) integral membrane protein
Organism
msm  Mycolicibacterium smegmatis MC2 155
SSDB
Motif
Pfam: SfLAP DUF3367
Other DBs
NCBI-ProteinID: ABK71066
UniProt: Q3L890
Position
465884..466702
AA seq 272 aa
MWSDILGLALFVSLNPLLLGFILLVLSRPRPVPNLVVFWVGCLIVNVPGFLIPLFVLRAV
PSFAEFAEDLTTADPSSGIEPFQLGTGIFALAVSAVIALRMWVKRRANQPVLVGSGAGDR
GPTDDASTLVLDSGAREAREPGAIARMILRMRSALQRLVSRLHQEWENGALWVALVFGLA
YIPPPPLVLLVDTIIGGSGAPIGTQIIAVFVFIMAMLAVFEITLLSYVIAPRRTQAVLEP
LHEWSHRHRQMILLVLFGAVGIWELIVGLGVI
NT seq 819 nt   +upstreamnt  +downstreamnt
atgtggagcgacatactcgggttggcactgttcgtgtcgctgaacccgttgcttctcggg
ttcatcctcttggtgctatcccgcccccgcccggtgcccaacctggttgttttctgggtt
ggttgcctcatcgtgaatgtgccgggcttcctgatcccgttgttcgtgctgcgcgcagta
ccgtcgttcgcggagttcgcagaagacctcacgacggcggatccgtcctccggcatcgag
ccgttccagttgggcaccggtatatttgccctggctgtcagcgcggtgatcgctcttcgc
atgtgggtgaaaaggcgagccaaccagccagtgctggtcggttcaggggccggggatcgg
ggccccacggatgacgcgtcgactctcgtgttggactcgggtgcgcgagaggcccgtgag
ccgggtgccatagccaggatgatcttgcgaatgagatcagcgcttcagcgcctcgtgagc
cgtctccaccaggagtgggagaacggcgcactatgggtggcgctggttttcggtctggcg
tacataccgccgccaccactggtgttgttggtcgacacgatcatcggaggatctggagct
ccgatcggcacccagatcatcgctgtcttcgtgttcatcatggccatgctcgcggttttt
gagatcacgcttctcagctacgtcatcgcgccgaggcggacccaggcggtgttggagccg
ctgcatgagtggtcgcacaggcaccgccagatgatcctgttggtccttttcggtgcggtc
gggatctgggagttgatcgtgggcctcggggtcatctga

DBGET integrated database retrieval system