KEGG   Mycobacterium smegmatis MC2 155: MSMEG_0432Help
Entry
MSMEG_0432        CDS       T00434                                 

Definition
(RefSeq) bifunctional uroporphyrinogen-III synthetase/response regulator domain-containing protein
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00860  Porphyrin and chlorophyll metabolism
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01120  Microbial metabolism in diverse environments
Module
msm_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MSMEG_0432
Enzymes [BR:msm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MSMEG_0432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Trans_reg_C Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 4532901
NCBI-ProteinID: YP_884845
UniProt: A0QPK7 I7FWE0
Position
complement(507499..508656)
Genome map
AA seq 385 aa AA seqDB search
MREPDWAPLTGFRVAVTSARRADELCALLRRRGATVTSAPAITMVPLPDDDELRAHTESL
ITDPPDIVVATTGIGLRGWIAAADGWGLAGELTEALGKARIVSRGPKATGALRAAGLPEE
WSPDSESSREVVRYLVEHGVDGRRIAVQLHGATDDWDPFPEFLDELRVAGAEVVPIRVYR
WHPAPPGGEFDQLVAGIAERRFDAVSFTSAPAVASVLMRATELGLTEQVVSALRTDVHAM
CVGPVTARPLVRLGIPTSAPERMRLGALARHITDELPLLQSRTLRVAGHLLEIRGTCVLV
DGVVKSLSPAGMATIRALAHRPGAVVSRFDLLGALPGSGTDTHAVETAVLRLRTALGDKS
IVSTVVKRGYRLAVDDTDTEMARAL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgagcccgactgggcacccctcaccggattccgggtggcggtgacctccgcccga
cgagccgatgaactgtgcgccctgctgcgcaggaggggcgcgacggtgaccagcgcgccc
gcgatcaccatggtgccgctgcccgacgacgacgaactgcgggcacacaccgagtcgttg
atcaccgacccgcccgacatcgtcgtcgccaccaccggcatcgggttgcgggggtggatc
gccgcagccgacggctggggcctggccggcgagctgaccgaggcgctgggcaaggctcgc
atcgtgtccagggggccgaaggccacgggggcactgcgggccgccgggttgccggaggag
tggtcgccggactccgaatcctcccgcgaggtggtccgctacctcgtcgagcacggcgtc
gacggccggcgcatcgccgtgcaactccacggcgccaccgacgactgggatccgttccct
gagttcctcgacgagctgcgtgtcgcgggtgcagaggtggtgccgatccgtgtctaccgg
tggcatcccgccccaccgggcggcgagttcgaccaactcgtcgcaggcatcgccgaacgg
cgcttcgacgcagtcagtttcacctcggccccggccgtcgcctcggtgctgatgagagcc
accgagttgggactgaccgagcaggtggtctccgcgctgcgcaccgacgtccacgcgatg
tgcgtcggaccggtcacggcgcgtccgctcgtgcgcctcggcattcccacgtcggcgccc
gagcgcatgcggttgggcgcactggcccgccacatcaccgacgagttgcccctgctgcag
tcccgtacgttgcgggtcgcgggtcacctcctcgagatccgcgggacctgcgtgctggtg
gacggcgtggtcaagtcgctgtcccccgcgggtatggccaccatccgggcgctcgcgcac
cggcccggcgcggtggtgtcacgtttcgatctgctgggcgcgctgcccggcagcgggacc
gacacccacgccgtcgagaccgcggtgctgcgccttcgaactgcattgggagacaagagc
atcgtgtccaccgtggtgaaaaggggttatcggctggcggtcgacgacaccgacacagag
atggcacgcgcgttatga

DBGET integrated database retrieval system