KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_0647
Entry
MSMEG_0647        CDS       T00434                                 
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter, ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
msm  Mycolicibacterium smegmatis MC2 155
Pathway
msm02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:msm00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    MSMEG_0647 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:msm02000]
    MSMEG_0647 (phnC)
Enzymes [BR:msm01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     MSMEG_0647 (phnC)
Transporters [BR:msm02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    MSMEG_0647 (phnC)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_16 RsgA_GTPase AAA_22 AAA_33 SbcC_Walker_B AAA_23 G-alpha
Other DBs
NCBI-ProteinID: ABK73331
UniProt: A0QQ70
Position
complement(730167..730958)
AA seq 263 aa
MNPVAGDDVVVIARDVTKRFGDTLALDHVSLDVHRSELLVLLGLSGSGKSTLLRCLNGLH
PVTSGTVDVGGTRVDQASGAQLRALRRRVGFVFQHFNLVGRLSCLENVLIGGLGRLRLPR
YGALTYPRHMRAEALAHLDRVGLADYADRRADTLSGGQQQRVAIARTLMQKPALLLADEP
VASLDPENAGVVMDLLFRVCIEEKLTVVCTLHQVDLALGWAHRLVGLQGGRKVLDRPAVG
MTRDDVMAVYQRVEPAVTPARRV
NT seq 792 nt   +upstreamnt  +downstreamnt
gtgaaccccgtcgcgggtgatgacgtcgttgtcatcgcgcgcgacgtcaccaaacgcttc
ggcgacacgctggccctggaccacgtatcactcgatgtccaccgcagcgaactcctcgtg
ctgctcggcctgtccggctcgggcaaatccacactgctgcgctgcctcaacggtttacat
ccggtgacctcgggaaccgtcgacgtcggcgggacacgtgtggaccaggcctcgggcgcc
cagttgcgggcgctgcgccgccgcgtcgggttcgtgttccagcacttcaatctcgtgggc
cggctcagctgcctggagaacgtcctcatcggcgggctgggccggctgcgcctgccgcgc
tatggcgcgctgacctatccccggcacatgcgggcggaggcactggcccacctcgaccgt
gtcgggctcgccgactacgccgaccgccgggccgacaccctctccggcggacaacagcag
cgcgtggccatcgcgcgcacgctgatgcagaagcccgccctgctgctcgccgacgaaccg
gtcgcgtcactggatcccgaaaatgccggcgtggtcatggatctgctgttccgcgtgtgc
atcgaggagaagctgaccgtggtgtgcacactgcaccaggtcgatctcgctctcggctgg
gcacaccgcctcgtgggcctgcagggtggtcgcaaagtcctcgaccggcccgccgtcggg
atgacgcgcgacgatgtcatggcggtctaccagcgcgtcgaacccgccgtcacccctgcg
cgtcgcgtatga

DBGET integrated database retrieval system