KEGG   Mycobacterium smegmatis MC2 155: MSMEG_3220Help
Entry
MSMEG_3220        CDS       T00434                                 

Gene name
trpB
Definition
(RefSeq) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00260  Glycine, serine and threonine metabolism
msm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01130  Biosynthesis of antibiotics
msm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSMEG_3220 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MSMEG_3220 (trpB)
Enzymes [BR:msm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MSMEG_3220 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Gmad2
Motif
Other DBs
NCBI-GeneID: 4531122
NCBI-ProteinID: YP_887534
UniProt: I7G1G4 A0QX96
Position
3297900..3299177
Genome map
AA seq 425 aa AA seqDB search
MAYHAGPDLPRSSAGVAEPTSHDPDARGHFGPYGGRLVPEALMAVIEEVTAAYEKCRGDQ
TFLDELDRLQRHYSGRPSPLYEATRLSEHAGGARIFLKREDLNHTGSHKINNVLGQALLA
RQMGKTRVIAETGAGQHGVATATACALLGLECVIYMGAVDTARQALNVARMRLLGATVVS
VEAGSKTLKDAINEAFRDWVTNADETYYCFGTAAGPHPFPLMVRDFQRIIGLEARVQVQD
QAGRLPDAVTACVGGGSNAIGIFHAFIDDPGVRLIGFEAAGDGVETGRHAATFTGGSPGA
FQGSFSYLLQDEDGQTIESHSISAGLDYPGVGPEHALLKDIGRAEYRPITDTEAMDAFRL
LCRTEGIIPAIESAHAVAGALKLGPELGAGSVIVVNLSGRGDKDVETAAKWFGLLDEGQG
EGEAR
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatcacgccggcccggacctgccgcgttccagcgcgggggtggccgaacccacg
tcccacgaccccgacgcgcgcgggcacttcggtccgtacggcggccgcctcgtccccgag
gcgctgatggcggtgatcgaagaggtcaccgccgcctacgagaagtgccgcggcgaccag
acgttcctcgacgaactcgaccgcctgcagcgtcactacagcggcaggccgtcgccgctg
tacgaggcgacgcggttgtccgagcacgccggcggcgcgcgcatcttcctcaagcgggaa
gacttgaaccacaccggatctcacaagatcaacaacgtgctggggcaggccctgctggcg
cgtcagatgggcaagacgcgcgtcatcgccgagaccggcgccggtcagcacggcgtggcc
accgcgaccgcgtgtgccctgctgggactcgagtgcgtcatctacatgggcgcggtcgac
acggcccgccaggcgctcaacgtcgcccgcatgcgactgctcggcgcgaccgtggtgtcg
gtcgaggccggttccaagaccctcaaggacgccatcaacgaggcgttccgcgactgggtg
accaacgccgacgagacgtactactgcttcggcaccgccgcgggcccgcatccgttcccg
ctcatggtccgtgacttccagcggatcatcggcctggaggcccgggttcaggtccaggac
caggccgggcggctgcccgacgcggtgaccgcatgcgtcggcggcggctcgaacgccatc
ggcatcttccacgccttcatcgacgatccgggtgtccgtctgatcggattcgaggccgca
ggcgacggcgtggagaccggcaggcacgccgcgaccttcaccggtggttcgcccggcgcg
ttccaggggtcgttctcctacctgttgcaggacgaggacgggcagaccatcgagtcccat
tcgatctcggcgggtctggactacccgggcgtcggacccgagcacgccctgctcaaggac
atcgggcgcgccgaataccggcccatcaccgacaccgaggccatggacgccttccgcctg
ctgtgccgcaccgaggggatcatcccggcgatcgaatccgcgcacgccgtggcgggtgcg
ctcaagctgggccccgaactcggcgcgggatcggtcatcgtggtgaacctgtccggacgt
ggtgacaaggacgtcgagaccgcggccaagtggttcggcctgctcgacgaaggacagggc
gaaggagaagcccgatga

DBGET integrated database retrieval system