KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_4278Help
Entry
MSMEG_4278        CDS       T00434                                 

Gene name
gcvT
Definition
(RefSeq) glycine cleavage system aminomethyltransferase T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
msm  Mycolicibacterium smegmatis MC2 155
Pathway
msm00260  Glycine, serine and threonine metabolism
msm00630  Glyoxylate and dicarboxylate metabolism
msm00670  One carbon pool by folate
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01130  Biosynthesis of antibiotics
msm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSMEG_4278 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSMEG_4278 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    MSMEG_4278 (gcvT)
Enzymes [BR:msm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     MSMEG_4278 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C 7TM_transglut
Motif
Other DBs
NCBI-GeneID: 4531056
NCBI-ProteinID: YP_888555
UniProt: A0R067 I7GD70
Position
complement(4361041..4362138)
Genome map
AA seq 365 aa AA seqDB search
MSDELLQGPLEDRHRELGAAFAEFGGWLMPVSYAGTVAEHNATRSTVGLFDVSHLGKALV
KGPGAAAYVNSALTNDLGKIGPGKAQYTLCCTESGGVIDDLIAYYVSDDEIFLVPNAANT
ATVVEELQRHAPDGLTITNEHRSYAVLAVQGPKSAEVLDKLGLPTDMDYMGYADAEFDGV
FVRVCRTGYTGEHGYELLPAWDRAGVVFDALVAAVRAAGGEPAGLGARDTLRTEMGYPLH
GHELSLDISPLQARCGWAVGWKKDAFWGRDALLAEKADGPKRVLRGLKALGRGVLRADLA
VLDGDTRVGVTTSGTFSPTLKVGIALALIDTEYDIADGTTVTVDVRGRAVECEVVKPPFV
TPSTR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgacgagctgctgcagggaccgttggaagaccgccaccgcgagctgggggccgcc
ttcgccgaattcggcggctggctgatgcccgtctcctatgcgggcacggtcgccgagcac
aacgcgacccgcagcaccgtgggcctgttcgacgtcagccacctcggcaaggcgctggtc
aaggggcccggcgcggcggcctacgtcaactccgcgctgaccaacgacctcggcaagatc
gggccgggcaaggcgcagtacacgttgtgctgcaccgaatccggcggggtgatcgacgac
ctgatcgcctactacgtctccgacgacgagatcttcctggtgcccaacgccgccaacacc
gccacggtggtcgaggaactgcagcggcacgcacccgacgggctgaccatcaccaacgaa
caccgctcgtacgccgtgctggcggtgcagggccccaagtccgccgaggtgctcgacaag
ctgggcctgcccaccgacatggactacatgggctacgctgacgccgagttcgacggcgtg
ttcgtgcgcgtgtgccgcaccgggtacaccggtgagcacggctacgaactgctgcccgca
tgggaccgcgccggcgtggtgttcgacgcgctggtcgcggccgtgcgcgctgcgggcggg
gaacccgcgggtctgggcgcccgcgacacgctgcgcaccgagatgggctacccgttgcac
ggccacgaactctcgctggacatctcgccgctgcaggcgcgctgcgggtgggcggtcggc
tggaagaaggacgcgttctgggggcgcgacgcgctgctcgccgagaaggccgacggcccg
aagcgcgtgctgcgcggtctcaaggcgctgggccgcggcgtgctgcgcgccgacctcgcg
gtgctcgacggggacacccgcgtcggcgtcacgacgtcgggcacgttctcgccgacgctc
aaggtgggcatcgcgctggcgctcatcgacaccgagtacgacatcgccgacggcaccacc
gtcacggtcgacgtgcgcggccgggcggtcgagtgcgaggtcgtcaaaccgccgttcgtc
acaccgagcacgcgatag

DBGET integrated database retrieval system