KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_4849
Entry
MSMEG_4849        CDS       T00434                                 

Definition
(GenBank) carveol dehydrogenase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
msm  Mycolicibacterium smegmatis MC2 155
Pathway
msm00903  Limonene and pinene degradation
msm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msm00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MSMEG_4849
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     MSMEG_4849
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Pterin_bind
Other DBs
NCBI-ProteinID: ABK69535
UniProt: A0R1R7
Position
4943348..4944193
AA seq 281 aa
MSGRVEGKVAFVTGAARGQGRSHALRLAQEGADIIAIDICGPIRPGAETAIPASTSDDLA
ETANLVKGLDRRVVTAEVDVRDAAAIKAAVDSGVEQLGRLDIIVANAGIGNGGDTLDQTS
EEDWDEMIDINLSGVWKSVKAGVPHIVAGGRGGSIVLTSSVGGLKAYPHCGNYVAAKHGV
VGLMRGFAVELGQHNIRVNTVHPTHVATPMLHNEGTFKMFRPDLENPGPDDMAPICQMFH
TLPIPWVEPIDISNAVLFLASDEARYITGVTLPVDAGSCLK
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtctggacgggtggaaggcaaggtcgcattcgtcaccggcgcggcccgcggccagggc
cgtagtcacgcactgcggttggcgcaggaaggcgccgacatcatcgccatcgacatctgc
ggccccattcgccccggcgccgaaaccgccatcccggcatcgacatccgatgaccttgcc
gagaccgcgaacctggtgaagggactcgaccgccgcgtcgtcaccgcggaggtggacgtg
cgcgacgccgcggccatcaaggccgctgtcgacagcggtgtcgagcagctcggcaggctc
gacatcatcgtcgccaacgccggcatcggcaacggcggcgacaccctcgaccagacctcc
gaggaggactgggacgagatgatcgacatcaatctgtccggtgtctggaagtctgtgaaa
gccggtgtcccccatatcgtcgcgggcggacgcggcgggtcgatcgtcctgaccagttcg
gtaggcgggctgaaggcctatccgcactgcggcaactacgtggccgccaagcacggcgtg
gtgggcctcatgcggggcttcgcagtggaactcgggcagcacaacatccgcgtcaacacc
gtgcacccgacgcacgtcgccaccccgatgctgcacaacgagggcaccttcaagatgttc
cgtcccgacctggagaacccgggccccgacgacatggcccccatctgccagatgttccac
acgttgcccatcccgtgggtcgagcccatcgacatcagcaacgccgtgctgttcctggcc
tccgacgaggcccgttacatcacgggcgtgacgttgccggtcgacgcgggaagctgcctc
aagtag

DBGET integrated database retrieval system