KEGG   Mycobacterium smegmatis MC2 155: MSMEG_4956Help
Entry
MSMEG_4956        CDS       T00434                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00260  Glycine, serine and threonine metabolism
msm00750  Vitamin B6 metabolism
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01120  Microbial metabolism in diverse environments
msm01230  Biosynthesis of amino acids
Module
msm_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MSMEG_4956 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MSMEG_4956 (thrC)
Enzymes [BR:msm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MSMEG_4956 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 4536683
NCBI-ProteinID: YP_889208
UniProt: A0R220
Position
complement(5052675..5053757)
Genome map
AA seq 360 aa AA seqDB search
MSAAKAAVHQPWPGLIEAYRDRLPIGDDWTTVTLLEGGTPLIHAKRISELTGCTVHLKVE
GLNPTGSFKDRGMTVAVTESLARGQQAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQVDGNFDDCLELARKLTADFPTIALVNSVNPYRIEGQKTAAFEI
VDALGTAPDVHALPVGNAGNITAYWKGYSEYHRDGVSDRLPRMLGTQAAGAAPLVTGAPV
KDPETIATAIRIGSPASWNSAVEAQQQSDGRFLAATDEEILAAYHLVARTEGVFVEPASA
ASIAGLLKSVEDGWVKRGSTVVCTVTGNGLKDPDTALKGMPQVTPVPVDPSAVVAELGLS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagcaaaggctgcggtgcaccagccctggccgggcctgatcgaggcctaccgg
gaccggctgccgatcggtgacgactggaccaccgtgacgctgttggagggcggtaccccg
ctgatccacgccaagcggatcagtgaactcaccggctgcacagtgcatctcaaggtcgag
gggctcaaccccaccggctccttcaaggaccgcggcatgaccgtggccgtcaccgagtcg
ctggcccgcggccagcaggccgtgctgtgcgcgtcgaccggcaacacctccgcgtcggcg
gcggcctacgccgcgcgcgcaggcatcacgtgcgccgtgctgatcccgcagggcaagatc
gccatgggcaagctggcgcaggcagtcatgcacggcgccaagatcatccaggtcgacggc
aacttcgacgactgtctcgagctggcccgcaaactcaccgccgacttcccgaccatcgcg
ctggtgaactcggtcaacccgtaccgcatcgaggggcagaagaccgcggcgttcgagatc
gtcgacgcgctgggcaccgctcccgacgtgcacgcgctgccggtcggcaacgcgggcaac
atcaccgcgtactggaagggctactccgagtaccaccgtgacggcgtctccgaccggttg
ccgcgcatgctcggcacgcaggccgcgggcgcggcgccgctggtgaccggcgcgccggtc
aaggatcccgagaccatcgccaccgcgatccgcatcggctcgcccgcgtcgtggaactcg
gccgtggaggcccagcagcagtccgacggccggttccttgccgcgaccgacgaggagatc
ctggccgcctaccacctggtcgcccgcaccgagggtgtgttcgtcgaaccggcgtctgcc
gcgagcatcgcgggcctgctcaagtcggtcgaagacggttgggtcaagcgcggttccacc
gtggtgtgcaccgtgaccggcaacggtctcaaggatcccgacaccgcgctcaagggcatg
ccccaggtcacccccgttcccgtcgacccgtccgcggtggtcgccgagctgggtctgagc
tag

DBGET integrated database retrieval system