KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_5021Help
Entry
MSMEG_5021        CDS       T00434                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
msm  Mycolicibacterium smegmatis MC2 155
Pathway
msm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:msm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MSMEG_5021
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     MSMEG_5021
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     MSMEG_5021
    1.1.1.-  
     MSMEG_5021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc
Motif
Other DBs
NCBI-GeneID: 4536308
NCBI-ProteinID: YP_889272
UniProt: I7G6L0 A0R284
Position
complement(5117738..5118784)
Genome map
AA seq 348 aa AA seqDB search
MKAAVYHGPNKLEIADLPEPQPGPGTVKVKVGFNGICGTDLHEYYAGPIFVPTEPHPLTG
QVMPLTMGHEFAGTITDVGAGVTGFAPGDRVAIEPIYRCGHCAPCRAGNYNVCQQIGFHG
LMCDGGMAEYTVVPVDMLHKLPDNVSLQLGALVEPMSVAYHAATLGDVGAGDTAVVFGAG
PIGIGLWFALRGKGLESVYVAEPSPTRRAAIEALGAQTLDPTQVDVPAFIADVTGGRGAD
AAFDAAGVAPAIEAATASVGSRRPTISVAIYEKPLTTPLLNLVMNESRIQGSLCYTSADF
EAVIALMADGVYDTTGWVTTIGIDDVIDEGFEALHAGRKMKVLIDPAI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgccgtctatcacggacccaacaaactggagatcgctgacctccccgaaccg
caaccgggaccgggcacggtcaaggtgaaggtcgggttcaacggaatttgtggcactgac
ctgcatgaatactatgcgggcccgatcttcgtgcccaccgaaccgcatccgctgaccgga
caggtcatgccgctgaccatggggcacgagttcgcaggcaccatcaccgatgtcggtgcg
ggtgtcaccgggttcgccccgggcgaccgcgtggcgatcgaaccgatctaccggtgcggc
cactgcgcgccgtgccgcgcaggcaactacaacgtgtgccaacagatcggtttccacggc
ctgatgtgcgacggcggcatggccgaatacaccgtcgtgccggtcgacatgctgcacaaa
ctgcctgacaacgtgtcgctgcaactcggcgcgctggtggaacccatgtcggtggcgtac
cacgcggcgaccctgggcgacgtgggtgcgggcgacaccgcggtggtcttcggtgccggc
cccatcggcatcgggttgtggttcgccttgcggggcaagggactcgagtcggtgtacgtc
gccgaaccgtcaccgacgcggcgcgccgcgatcgaggcgctcggtgcgcagacactggat
ccgacgcaggtcgacgtgcccgcgttcatcgccgacgtgaccggtgggcgtggggccgat
gcggccttcgacgcggccggggtggcgccggcgatcgaggccgccaccgcgagtgtcggt
tcgcgacggccgaccatcagtgtcgcgatctacgagaagccgttgaccacaccgctgctg
aacctcgtgatgaacgagtcccgtatccagggctcgctgtgttacacgtcggccgacttc
gaggcggtgatcgccctgatggccgacggcgtgtacgacaccacggggtgggtcaccacg
atcggcatcgacgacgtgatcgacgagggattcgaggcactgcacgcgggccgcaagatg
aaggtcctcatcgacccggccatctga

DBGET integrated database retrieval system