KEGG   Mycobacterium smegmatis MC2 155: MSMEG_5436Help
Entry
MSMEG_5436        CDS       T00434                                 

Gene name
ispE
Definition
(RefSeq) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00900  Terpenoid backbone biosynthesis
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01130  Biosynthesis of antibiotics
Module
msm_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MSMEG_5436 (ispE)
Enzymes [BR:msm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     MSMEG_5436 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 4537206
NCBI-ProteinID: YP_889675
UniProt: A0R3D7
Position
complement(5519402..5520370)
Genome map
AA seq 322 aa AA seqDB search
MAVPASDGSTASEWVTTGSVTVRVPGKVNLYLSVGDLRDDGYHDLTTVFHAVSLLDEVTV
RNADVLSLRMIGEGAESLPADERNLAWRAAELMAEHVGRAPDVEITIEKSIPVAGGMAGG
SADAAGVLVAMNTLWELGVPRRDLHALAAQLGSDVPFALHGGTALGSGRGEDLATVLARN
TFHWVLAFAHRGLSTPKVFGELDRLRADTTRGLPRTDEPEPVLAALASGDPAELAALLGN
DLQPAALSLYPDLRRTLRAGVEAGALAGIVSGSGPTCAFLCASAPAALDVGTQLSGAGVC
RTVRVASGPVHGAHVVPAPSAS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtggccgtgcccgcatccgatggcagtaccgcttccgaatgggtgaccaccggctcggtc
accgtgcgcgtccccggcaaggtgaacctgtacctgtccgtgggcgatctgcgcgacgac
gggtaccacgatctgacgacggtgttccacgcggtctcgctgctcgacgaggtgacggtc
cgcaacgccgacgtgctgtcgctgcggatgatcggggagggcgccgagtcgctgccggcc
gacgagcgcaatctggcgtggcgcgccgccgagttgatggccgagcacgtcggccgcgcc
cccgatgtcgagatcacgatcgagaagtccatcccggtggccggcgggatggccggtggc
tcggcggatgccgcgggcgtgctggtcgcgatgaacacgctgtgggagctcggcgtgccg
cggcgggatctgcacgcgctggccgcacagctgggcagtgatgtgccgttcgcgctgcac
ggcgggaccgcgctggggtccgggcgcggcgaggacctcgccacggtactcgcgcgcaac
acgttccactgggtgctggcgttcgcgcaccgtggcttgtcgacgcccaaggtcttcggg
gaactggaccggttgcgcgccgacaccacccgtggtctgccgcgcaccgacgagcccgag
cccgtgctggccgcgctggcctcgggcgatccggccgagctggcggccctgctgggcaac
gatctgcagcccgcggcgctgagcctgtatcccgacctgcgtcgcacgctgcgtgccggt
gtcgaggcgggtgcgctcgcgggcatcgtgtcggggtccggtccgacgtgtgcgttcctg
tgtgcgtcggccccggccgcactggatgtcggcacgcagctgtcgggggccggggtgtgc
cgcaccgtgcgcgtggcgagcgggcctgtacacggcgcgcacgtcgttcccgcgccgtcg
gcatcgtga

DBGET integrated database retrieval system