KEGG   Mycobacterium smegmatis MC2 155: MSMEG_5521Help
Entry
MSMEG_5521        CDS       T00434                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00071  Fatty acid degradation
msm00072  Synthesis and degradation of ketone bodies
msm00280  Valine, leucine and isoleucine degradation
msm00310  Lysine degradation
msm00362  Benzoate degradation
msm00380  Tryptophan metabolism
msm00620  Pyruvate metabolism
msm00630  Glyoxylate and dicarboxylate metabolism
msm00640  Propanoate metabolism
msm00650  Butanoate metabolism
msm00900  Terpenoid backbone biosynthesis
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01120  Microbial metabolism in diverse environments
msm01130  Biosynthesis of antibiotics
msm01200  Carbon metabolism
msm01212  Fatty acid metabolism
msm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSMEG_5521
   00630 Glyoxylate and dicarboxylate metabolism
    MSMEG_5521
   00640 Propanoate metabolism
    MSMEG_5521
   00650 Butanoate metabolism
    MSMEG_5521
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MSMEG_5521
   00072 Synthesis and degradation of ketone bodies
    MSMEG_5521
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MSMEG_5521
   00310 Lysine degradation
    MSMEG_5521
   00380 Tryptophan metabolism
    MSMEG_5521
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MSMEG_5521
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEG_5521
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MSMEG_5521
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msm04147]
    MSMEG_5521
Enzymes [BR:msm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MSMEG_5521
Exosome [BR:msm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MSMEG_5521
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N DUF2560
Motif
Other DBs
NCBI-GeneID: 4534167
NCBI-ProteinID: YP_889758
UniProt: I7FKH8 A0R3M0
Structure
PDB: 

Position
complement(5609621..5611144)
Genome map
AA seq 507 aa AA seqDB search
MVDPRTPVIVGVGQFTERIDLDGYRGMSSVELATEAAKAALHDCGADADTVARAIDTVAG
TRQFEISGPASAPLGVSSNYPRSVARNIGADPAHAVLEVIGGQSPQHLATEFGGKIAAGE
NDVVLIFGSENTSTLRHFSKAENKPDHSETVDGQLEDRGYGYDGIFDEYTIRHGLIGAPV
QYGLLENARRARLGLSVADYRLAMAELFAPFSKVAAKNPYSSAPTERSVEELLTVTASNR
MIVDPYPRLMVARDQVNQGAALLMMSVESARKLGVPEEKWVYLRGHADMKEPKLLERADI
GASPASVTAVNEALRVAGIGLDDVAAFDLYSCFPFPVFNICDGTGLATDDPRGLTLTGGL
PFFGGLGNNYSMHGIAEAVNEMRDKPGQFALVGANGGIASKYSVGIYSTEPADWVADNSA
QLQAEHDAQPKVAITEKADGTGTIETYTVRYDWTPHTGIIIGRLDDGSRFLAKTKDEDLV
KLLSEGDPIGAKIVVTPGEKSNRAVLA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatccgcgtacgcctgtcatcgtcggcgtgggacagttcaccgaacgcatcgat
ctcgacggttatcggggcatgtcgtcggtcgagctggcgaccgaggccgcgaaggccgcc
ctgcatgactgcggggccgacgcggataccgtggcgcgcgccatcgacaccgtggcaggt
acccggcagttcgagatctccggcccggcatcggccccgctcggcgtctccagcaactac
ccgcgctcggtcgcgcgcaacatcggcgccgacccggcccatgccgtgctcgaggtgatc
ggcgggcagagcccgcagcacctcgcgacggagttcggcggcaagatcgcggccggtgag
aacgacgtcgtgctgatcttcggctcggagaacacctccacgctgcgccacttctccaag
gccgagaacaagccggaccactccgagaccgtcgacgggcagttggaggaccgcggctac
gggtacgacggaatcttcgacgagtacacgatccgccacggcctgatcggtgccccggtg
cagtacggccttctggagaacgcccgccgcgcccgcctgggcctctcggttgccgactat
cgcctcgcgatggccgagctgtttgccccgttctcgaaagtggccgccaagaacccgtat
tcgtcggcgccgacggagcgctcggtcgaggaactgctcaccgtcactgcatcgaatcgc
atgatcgtcgacccctacccgcgtctgatggtcgcgcgcgaccaggtgaaccagggtgcc
gcgctgctgatgatgtcggtggaatccgcacgcaaactcggtgtgcccgaagagaagtgg
gtgtacctgcgcgggcacgccgacatgaaggagcccaagctgctggagcgcgccgacatc
ggtgccagcccggcctcggtgaccgcggtgaacgaggcgctgcgcgtggccggtatcggc
ttggacgacgtggcggccttcgatctgtacagctgcttcccgttcccggtgttcaacatc
tgcgacggcacagggctggccaccgacgacccgcgtggcctcactctcaccggcggactg
ccgttcttcggcggcctgggcaacaactactcgatgcacggcatcgccgaggcggtcaac
gagatgcgtgacaagcccggtcagttcgcgctcgtcggcgccaacggcggcatcgccagc
aagtactcggtgggcatctactcgaccgagcccgccgactgggtcgccgacaacagcgcg
caactgcaggccgagcacgacgcgcagcccaaggtcgccatcaccgagaaggccgacggc
acaggcaccatcgagacctacaccgtgcgctacgactggacgccgcacaccggcatcatc
atcggccgtctcgacgacggcagccgcttcctggccaagaccaaggacgaggacctggtc
aagctgctcagcgagggcgacccgatcggcgcgaagatcgtcgtcacccccggcgagaag
agcaaccgcgccgtactggcgtaa

DBGET integrated database retrieval system