KEGG   Mycobacterium smegmatis MC2 155: MSMEG_5525Help
Entry
MSMEG_5525        CDS       T00434                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00020  Citrate cycle (TCA cycle)
msm00640  Propanoate metabolism
msm00660  C5-Branched dibasic acid metabolism
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01120  Microbial metabolism in diverse environments
msm01130  Biosynthesis of antibiotics
msm01200  Carbon metabolism
Module
msm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MSMEG_5525 (sucC)
   00640 Propanoate metabolism
    MSMEG_5525 (sucC)
   00660 C5-Branched dibasic acid metabolism
    MSMEG_5525 (sucC)
Enzymes [BR:msm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MSMEG_5525 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-GeneID: 4535810
NCBI-ProteinID: YP_889762
UniProt: A0R3M4
Position
complement(5614853..5616016)
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPTSPGRVTDSAEDAKTIAEEIGRPVMVKAQVKTGGRGKAGGVK
YAATPDDAFTHANNILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRANRTYLAMCSVE
GGMEIEEVAATKPERLAKVPVDAVKGVDLAFARSIAEQGHLPAEVLDAAAVTIQKLWEVF
VKEDATLVEVNPLVRTPDDQILALDGKVTLDENAGFRQPGHAEFEDRDATDPLELKAKEN
DLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGENHGGVKPANFLDIGGGASAAVMAAGLD
VILGDSQVKSVFVNVFGGITACDAVANGIVQALQILGDEANKPLVVRLDGNNVEEGRRIL
AEANHPLVIQAETMDAGADKAAELANK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatctcttcgaataccaggcgaaagagctgttcgccaagcacaacgtcccgacatca
cccggccgggtgaccgattccgccgaggacgccaagacgatcgccgaggaaatcggccgc
cccgtgatggtgaaagcccaggtcaagaccggtggtcgcggcaaggccggtggcgtgaag
tacgcagccacccccgatgacgcgttcactcacgcaaacaacatcctcggcctcgacatc
aagggccacgtggtcaagaagttgctcgtggccgaggcgagcgacatcgccgaggagtac
tacatctccttcttgctcgatcgcgccaaccgcacctacctggccatgtgctcggtcgag
ggtggcatggagatcgaggaagtggccgccaccaagcccgagcgtctcgcgaaggttcct
gtcgacgccgtcaagggtgtcgacctggcgttcgcccgttcgatcgccgagcaaggccac
ctgcccgccgaggtgctcgacgccgccgcggtgaccatccagaagctgtgggaggtgttc
gtcaaggaggacgccaccctggtggaggtcaacccgctggtgcgcacccccgacgatcag
atcctcgccctcgacggcaaggtcaccctcgacgagaacgccggcttccgtcagcccggc
cacgccgagttcgaggaccgcgacgccaccgatcctcttgagctcaaggccaaggagaac
gacctcaactacgtcaagctcgacgggcaggtcggcatcatcggcaacggcgccggtctg
gtcatgtcgacgctggacgtcgtcgcctacgcgggtgagaaccacggcggcgtgaagccc
gccaacttcctggacatcggcggtggcgcctcggccgccgtgatggccgcgggtctggac
gtcattctgggcgacagccaggtcaagagcgtgttcgtcaacgtcttcggtggcatcacc
gcgtgtgacgccgtcgccaacggcatcgtgcaggccctgcagatcctgggcgacgaggcc
aacaagccgctggtcgtgcgtctggacggcaacaacgtcgaagagggccggcgcatcctg
gccgaagccaaccaccccctggtcatccaggccgagaccatggacgccggtgccgacaag
gccgccgagctggcgaacaagtaa

DBGET integrated database retrieval system