KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_5570Help
Entry
MSMEG_5570        CDS       T00434                                 

Definition
(RefSeq) ATP-dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
msm  Mycolicibacterium smegmatis MC2 155
Pathway
msm03030  DNA replication
msm03410  Base excision repair
msm03420  Nucleotide excision repair
msm03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:msm00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MSMEG_5570
   03410 Base excision repair
    MSMEG_5570
   03420 Nucleotide excision repair
    MSMEG_5570
   03430 Mismatch repair
    MSMEG_5570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:msm03032]
    MSMEG_5570
   03400 DNA repair and recombination proteins [BR:msm03400]
    MSMEG_5570
Enzymes [BR:msm01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MSMEG_5570
    6.5.1.6  DNA ligase (ATP or NAD+)
     MSMEG_5570
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MSMEG_5570
DNA replication proteins [BR:msm03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    MSMEG_5570
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     MSMEG_5570
DNA repair and recombination proteins [BR:msm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     MSMEG_5570
   NER (nucleotide excision repair)
    Other NER factors
     MSMEG_5570
   MMR (mismatch excision repair)
    Other MMR factors
     MSMEG_5570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase Thr_synth_N
Motif
Other DBs
NCBI-GeneID: 4535131
NCBI-ProteinID: YP_889805
UniProt: A0R3R7
Position
complement(5656824..5659091)
Genome map
AA seq 755 aa AA seqDB search
MERYERVRLTNPDKVLYPATGTTKAEVFDYYLSIAQVMVPHIAGRPVTRKRWPNGVAEEA
FFEKQLASSAPSWLERGSITHKSGTTTYPIINTREGLAWVAQQASLEVHVPQWRFEDGDQ
GPATRIVFDLDPGEGVTMTQLCEIAHEVRALMTDLDLETYPLTSGSKGLHLYVPLAEPIS
SRGASVLARRVAQQLEQAMPKLVTATMTKSLRAGKVFLDWSQNNAAKTTIAPYSLRGRDH
PTVAAPRTWDEIADPELRHLRFDEVLDRLDEYGDLLAPLDADAPIADKLTTYRSMRDASK
TPEPVPKEIPKTGNNDKFVIQEHHARRLHYDLRLERDGVLVSFAVPKNLPETTAENRLAV
HTEDHPIEYLAFHGSIPKGEYGAGDMVIWDSGSYETEKFRVPEELDNPDDSHGEIIVTLH
GEKVDGRYALIQTKGKNWLAHRMKDQKNARPEDFAPMLATEGSVAKYKAKQWAFEGKWDG
YRVIIDADHGQLQIRSRTGREVTGEYPQFKALAADLAEHHVVLDGEAVALDESGVPSFGQ
MQNRARSTRVEFWAFDILWLDGRSLLRAKYSDRRKILEALADGGGLIVPDQLPGDGPEAM
EHVRKKRFEGVVAKKWDSTYQPGRRSSSWIKDKIWNTQEVVIGGWRQGEGGRSSGIGALV
LGIPGPEGLQFVGRVGTGFTEKELSKLKDMLKPLHTDESPFNAPLPKVDARGVTFVRPEL
VGEVRYSERTSDGRLRQPSWRGLRPDKTPDEVVWE
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggagcgctatgagcgggttcgcctgacgaatcctgacaaggtgctctatcccgccacg
ggcaccaccaaggcagaggttttcgactactacctcagcatcgcgcaggtgatggtgccg
cacatcgccgggcggccggtgacgcgcaaacgctggcccaacggcgtcgcggaagaggcg
ttcttcgagaagcagttggcgtcgtcggccccgagctggctggaacgtggctcgatcacg
cacaaatcgggcaccacgacgtacccgatcatcaacacgcgtgagggtctggcgtgggtc
gcgcagcaggcctcgctggaagtgcatgtgccgcaatggcgcttcgaggacggggatcag
ggtccggccacgcggatcgtgttcgacctcgatccgggcgaaggcgtcacgatgacgcaa
ttgtgcgagatcgcccacgaggtgcgcgcgctgatgaccgacctcgatctcgagacgtac
ccgctcaccagcggcagcaagggcctgcacctgtatgtgccactggccgagccgatcagc
tcccgcggcgcgtcggtgctcgcgcgccgggttgcccagcagctggagcaggccatgccg
aagctggtcaccgccaccatgaccaagagcctgcgggctggcaaggtgttcctggattgg
agccaaaacaacgcggccaagactacgatcgcgccgtactcgctgcgggggcgcgaccat
ccgacggtcgccgcgccgcgtacgtgggacgagatcgccgatccggaactgcggcatctg
cggttcgacgaggtactggaccggctcgacgaatacggtgatctactggcaccgctcgac
gccgacgcaccgatcgccgacaagctcacgacctaccgcagcatgcgcgacgcgtcgaag
acgcccgagccggtgccgaaagagattccgaagaccggtaacaacgacaagttcgtcatc
caggagcaccacgcccggcggctgcactatgacctgcgactcgagcgtgacggtgttctc
gtgagcttcgcggtgcccaagaacctgcccgagaccaccgcggagaaccggctcgcggtg
cacaccgaggaccaccccatcgagtacctggcgtttcacggctcgattcccaagggcgag
tacggcgccggtgacatggtgatctgggattcgggtagctacgagaccgagaagttccgt
gtgcccgaggaactcgacaaccctgacgacagtcacggcgagatcatcgtcacgctgcac
ggcgagaaggtcgacggcaggtatgcgttgatccagaccaagggcaagaactggctcgcg
caccgcatgaaggaccagaagaacgcgcggccagaggatttcgcgcccatgctggccacc
gagggttccgtcgcgaagtacaaggccaagcagtgggcgttcgagggcaaatgggacggc
taccgcgtgatcatcgacgccgatcacggccagttgcagatacgttcgcgcaccggtcgt
gaggtgaccggtgagtacccccaattcaaggcgctggcagccgatctcgccgaacatcat
gtggtgctcgacggcgaggcggtcgcgttggacgagtcaggtgtgcccagtttcggccag
atgcagaaccgtgcccgctccacgcgggtcgagttctgggccttcgacatcctgtggctc
gacggccggtcgctgttgcgggccaagtactccgaccggcgcaagatcctggaagcgctg
gccgacggtggcggactgatcgtcccggaccagttgcccggcgacgggcccgaggccatg
gagcacgtgcgcaagaaacgcttcgagggtgtcgtcgccaagaaatgggactcgacgtat
caaccaggtcgacggtcgtcatcgtggatcaaggacaagatctggaacacccaggaggtc
gtgatcggcggttggcgtcagggtgagggtggacggtccagcggtatcggcgcactcgtg
ctcggcattccggggcccgaaggcctgcagttcgtgggacgcgtcggaacggggttcacc
gagaaagaactgagcaagctcaaggacatgctgaagccgctgcacaccgacgagtccccc
ttcaacgcgccactgcccaaggtcgacgcccgcggcgtcaccttcgtgcgcccggaactg
gtgggggaggtgcgctacagcgagcgcacatcggacggccggttgcgtcaaccgagttgg
cgtgggctgcgccccgacaagacacccgatgaggttgtgtgggaatag

DBGET integrated database retrieval system