KEGG   Mycobacterium smegmatis MC2 155: MSMEG_5720Help
Entry
MSMEG_5720        CDS       T00434                                 

Definition
(RefSeq) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00071  Fatty acid degradation
msm00280  Valine, leucine and isoleucine degradation
msm00281  Geraniol degradation
msm00310  Lysine degradation
msm00362  Benzoate degradation
msm00380  Tryptophan metabolism
msm00410  beta-Alanine metabolism
msm00640  Propanoate metabolism
msm00650  Butanoate metabolism
msm00903  Limonene and pinene degradation
msm00930  Caprolactam degradation
msm01040  Biosynthesis of unsaturated fatty acids
msm01100  Metabolic pathways
msm01110  Biosynthesis of secondary metabolites
msm01120  Microbial metabolism in diverse environments
msm01130  Biosynthesis of antibiotics
msm01200  Carbon metabolism
msm01212  Fatty acid metabolism
Module
msm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MSMEG_5720
   00650 Butanoate metabolism
    MSMEG_5720
  Lipid metabolism
   00071 Fatty acid degradation
    MSMEG_5720
   01040 Biosynthesis of unsaturated fatty acids
    MSMEG_5720
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MSMEG_5720
   00310 Lysine degradation
    MSMEG_5720
   00380 Tryptophan metabolism
    MSMEG_5720
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MSMEG_5720
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MSMEG_5720
   00281 Geraniol degradation
    MSMEG_5720
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEG_5720
   00930 Caprolactam degradation
    MSMEG_5720
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     MSMEG_5720
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MSMEG_5720
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     MSMEG_5720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 4531617
NCBI-ProteinID: YP_889953
UniProt: I7FT13 A0R465
Position
complement(5803163..5805325)
Genome map
AA seq 720 aa AA seqDB search
MAENTIKWDKDADGIVTLTLDDPTGSANVMNEHYKESMHNAVERLAAEKDSITGVVITSA
KKTFFAGGDLKGMMKVGPENAAESFAEVEFIKADLRKLETLGVPVVAAINGAALGGGLEI
ALACHHRIAADVKGVVIGLPEVTLGLLPGGGGVARTVRMFGIQKAFMEVLSQGTRFKPGK
ALEVGLVDQLVSSVDELVPAAKAWITEELKANPETVAVQPWDRKGYKMPGGTPSSPALAS
ILPSFPALLRKQLKGAPMPAPRAILAAAVEGAQVDFDTATRIESRYFVSLVTGQTAKNMI
QAFFLDMQTINGGGSRPDGIAKQEIKKVGVLGAGMMGAGIAYVSARAGFEVVLKDVTLEA
AERGKGYSEKIEAKALERGRTTKEKSDALLARITPTADAADLKGVDFVIEAVFENQELKH
KVFQEIEDIVEPNAILGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEK
TSDEALARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVPAASIEQAGS
QAGYPAPPLQLSDELNLELMQKIATETRKAAEATGATYEPHPAEAVVNKMIEIGRPSRLK
GAGFYEYVDGKRVGLWPGLADTFGSGKVDIPLQDMIDRMLFAEALETQKCIDEGVLTSTA
DANIGSIMGIGFPPYTGGSAQFIVGYQGELGVGKEAFVARAKQLAERYGERFNPPASLES
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaacaccatcaagtgggacaaggatgccgacggcatcgtcacgctgacgctc
gacgacccgaccggctcggccaacgtgatgaacgagcactacaaggaatccatgcacaac
gccgtggaacgccttgccgcagagaaggattcaatcaccggtgtcgtcatcaccagcgcg
aagaagacattcttcgccggtggtgacctcaagggcatgatgaaggtcggccctgagaac
gcggccgagtccttcgccgaggtcgagttcatcaaggctgatttgcgcaagctcgagacc
ctgggcgtgcccgtggtggccgccatcaacggcgccgcgctcggcggcggcctggagatc
gcactggcgtgccatcaccgcatcgccgccgacgtcaagggcgtggtgatcggtctgccc
gaggtcaccctcggcctgctgcccggcggcggcggtgtcgcccgcaccgtccggatgttc
ggcatccagaaggccttcatggaggtgctctcgcagggcacccggttcaagccgggcaag
gccctggaagtcgggcttgtggatcagctcgtctcgtcggtggatgagctcgtgcccgcc
gccaaggcttggatcacagaagagctcaaggccaaccccgagacggttgccgttcagccg
tgggatcggaagggctacaagatgcccggcggcaccccgtccagccccgcgctggcgagc
atcctcccgtcgttcccggctctgctgcgcaagcagctcaagggtgcgccgatgcctgcg
ccgcgggccatcctggccgcggcggtcgagggtgcgcaggtcgacttcgacaccgccacc
cgtatcgagagccgctacttcgtcagcctcgtcaccggccagaccgccaagaacatgatc
caggcgttcttccttgacatgcagaccatcaacggtggtggttcgcggcccgacggcatc
gccaagcaggagatcaagaaggtcggtgtccttggtgcgggcatgatgggcgccggtatc
gcctacgtgtcggccagggccggcttcgaggtcgtgctcaaggacgtcacgctggaggcg
gccgagcggggcaagggctactccgagaagatcgaagccaaggcgctcgagcgtggcagg
accaccaaggaaaagtccgacgcgctgctggcccggatcaccccgaccgccgacgcggcc
gacctcaagggtgtggacttcgtcatcgaggccgtcttcgagaatcaggaactcaagcac
aaggtgttccaggagatcgaggacatcgtcgagcccaacgcgatcctcggctcgaacacc
tccacgctgccgatcaccggtctggcgaccggtgtgaagcgccaggaggacttcatcggc
atccacttcttctctccggtcgacaagatgccgctggtggagatcatcaagggcgagaag
acctccgacgaggcgctggcccgggtgttcgactacacgctggccatcggcaagacgccg
atcgtggtcaacgacagccgcggcttcttcaccagccgcgtcatcggcaccttcgtcaac
gaagccctggcgatgctcggtgagggcgtgcccgcggccagcatcgagcaggcgggttca
caggccggctacccggctccgccgctgcagctgtccgacgagctcaacctcgagctgatg
cagaagatcgcgaccgagacccgcaaggccgccgaggccacgggcgccacctatgagccg
catccggccgaagcggtggtgaacaagatgatcgagatcggtcgtccgtcgcgtctgaag
ggcgccggcttctacgaatatgtcgacggcaagcgcgtcggcctgtggccgggtctggcc
gacacgttcggctcgggcaaggtcgacatccccctgcaggacatgatcgaccgcatgctg
ttcgccgaggcgctggagacccagaagtgcatcgacgaaggtgtgctgacatcgaccgct
gacgccaacatcggctcgatcatgggtatcggcttcccgccgtacaccggcggcagtgcg
cagttcatcgtgggctaccagggtgagctgggtgtcggcaaggaggctttcgtggcccgc
gccaagcagctggccgagcgctacggcgagcggttcaacccgcctgcctcgctggagtcc
tga

DBGET integrated database retrieval system