KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_5837Help
Entry
MSMEG_5837        CDS       T00434                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
msm  Mycolicibacterium smegmatis MC2 155
Pathway
msm00480  Glutathione metabolism
msm00590  Arachidonic acid metabolism
msm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    MSMEG_5837
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MSMEG_5837
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MSMEG_5837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 4534839
NCBI-ProteinID: YP_890064
UniProt: A0R4H6 I7GFS6
Position
complement(5903317..5903802)
Genome map
AA seq 161 aa AA seqDB search
MSLKNINLTTLDGKQTTLGELAPGAALVVNVASKCGLTPQYSALEKLAQEYGDRGLTVIG
VPCNQFMGQEPGTAEEIQTFCSTTYGVTFPLLAKTDVNGAERHPLYAALTETPDAGGEAG
DIQWNFEKFLLAADGTVVNRFRPRTEPDAPEVIEAIEKVVS
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctcaagaacatcaacttgaccaccctcgacggcaagcagaccacgctcggcgag
ttggcccctggggccgcactcgtcgtcaacgtcgcctcgaaatgcggtctgacaccgcaa
tacagcgcactggagaaactcgcgcaggaatacggtgaccgcggcctcacggtgatcggt
gtgccctgtaaccaattcatgggacaggaaccgggcacggccgaggaaattcagacgttc
tgttcgaccacctacggcgtgacgttcccgttgctggccaagaccgacgtcaacggcgca
gagcgccacccgctgtacgccgcactgaccgagacccccgacgccggtggcgaggcgggc
gacatccagtggaacttcgagaagttcctgctggccgccgatggcaccgtcgtcaaccgg
ttccggccccgcacagaaccggacgcccctgaggtgatcgaggcgatcgagaaggtcgtt
tcgtaa

DBGET integrated database retrieval system