KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_5937Help
Entry
MSMEG_5937        CDS       T00434                                 

Definition
(RefSeq) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
msm  Mycolicibacterium smegmatis MC2 155
Pathway
msm00360  Phenylalanine metabolism
msm00362  Benzoate degradation
msm00621  Dioxin degradation
msm00622  Xylene degradation
msm01100  Metabolic pathways
msm01120  Microbial metabolism in diverse environments
msm01220  Degradation of aromatic compounds
Module
msm_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    MSMEG_5937
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEG_5937
   00622 Xylene degradation
    MSMEG_5937
   00621 Dioxin degradation
    MSMEG_5937
Enzymes [BR:msm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     MSMEG_5937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-GeneID: 4530906
NCBI-ProteinID: YP_890164
UniProt: A0R4S6
Position
complement(5997153..5998202)
Genome map
AA seq 349 aa AA seqDB search
MSDIFFNPIWDVRMTDTSLRDGSHHKRHQFTGEEVRSIVAALDAAGVPVIEVTHGDGLGG
SSFNYGFSKTPEQELIKIAAETAKESKIAFLMLPGVGTKEDIKEAQNNGGSICRIATHCT
EADVSIQHFGLARELGLETVGFLMMAHTISPEKLAQQARIMADAGCQCVYVVDSAGALVL
EGVRDRVQALVAELGSDAQVGFHGHENLGLGVANSVEAVRAGAKQIDGSCRRFGAGAGNA
PVEALIGVFDKIGVKTGIDFFDIADAAEEVVAPAMPAECLLDRNALIMGYSGVYSSFLKH
AIRQSERYGVPAHQLLHRAGQRKLIGGQEDQLIDIALEIKREQEAAASK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcttcttcaaccccatctgggacgtccgcatgaccgacacgtcgctgcgc
gacgggtcgcaccacaagcggcatcagttcaccggtgaagaggtgcggtccatcgtcgcg
gcgctcgacgccgccggtgtgccggtcatcgaggtgacccacggcgacggccttggcggg
tcgagcttcaactacggcttctccaagacgcccgaacaggaactcatcaagatcgcggcc
gagacagccaaggaatccaagatcgccttcctcatgctgcccggtgtgggcaccaaggag
gacatcaaggaggcgcagaacaacggcggttcgatctgccgcatcgcgacccactgcacc
gaggccgacgtgtcgatccagcacttcggcctggcacgtgaactgggcctggagaccgtg
ggctttttgatgatggcccacaccatctcaccggagaagctcgcccagcaggcccgcatc
atggccgacgccggctgccagtgcgtctacgtcgtcgactcggccggtgcgctggtgctc
gaaggcgttcgcgaccgcgtgcaggcgctggtcgccgaactgggctcggacgcccaggtc
ggtttccacggtcacgagaacctcggcctgggcgtcgcgaactcggtcgaggccgtgcgc
gcgggcgccaagcagatcgacggctcctgcaggcggttcggtgcgggcgcgggcaacgca
cccgtcgaggcgctcatcggcgtgttcgacaagatcggcgtcaagaccggcatcgacttc
ttcgacatcgccgacgcggccgaagaggtggtggccccggccatgcccgccgagtgcctg
ctggaccgcaacgcgctgatcatgggctactcgggcgtgtactccagcttcctcaagcat
gcgatccggcagtccgagcggtacggcgtgccggcacatcagctgctgcaccgcgcgggt
cagcgcaagctcataggcggtcaggaagaccagctcatcgacatcgcgctggagatcaag
cgtgagcaggaagccgccgcgtccaagtag

DBGET integrated database retrieval system