KEGG   Mycobacterium smegmatis MC2 155: MSMEG_5939Help
Entry
MSMEG_5939        CDS       T00434                                 

Definition
(RefSeq) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm00360  Phenylalanine metabolism
msm00362  Benzoate degradation
msm00620  Pyruvate metabolism
msm00621  Dioxin degradation
msm00622  Xylene degradation
msm00650  Butanoate metabolism
msm01100  Metabolic pathways
msm01120  Microbial metabolism in diverse environments
msm01220  Degradation of aromatic compounds
Module
msm_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:msm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MSMEG_5939
   00650 Butanoate metabolism
    MSMEG_5939
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MSMEG_5939
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MSMEG_5939
   00622 Xylene degradation
    MSMEG_5939
   00621 Dioxin degradation
    MSMEG_5939
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MSMEG_5939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA
Motif
Other DBs
NCBI-GeneID: 4531880
NCBI-ProteinID: YP_890165
UniProt: A0R4S7
Position
complement(5998199..5999164)
Genome map
AA seq 321 aa AA seqDB search
MMSSTKTFEQLGETMPKKSSVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPESEGLAR
ARKLGLETSAEGVDWLLAQSEKPDLVFEATSAYVHRDAAPRYEEAGIRAIDLTPAAVGPG
VVPPANLRDHLDAPNVNMVTCGGQATIPIVHAVSRVVDVPYAEIVASVSSASAGPGTRAN
IDEFTKTTSAGVQNIGGAQRGKAIIVLNPAEPPMIMRDTIFCAIPEGADHDAITQSIKDV
VAEVQTYVPGYRLLNEPQFDEPSVVNGGNHLVTTFVEVEGAGDYLPPYAGNLDIMTAAAT
KVGEEIAKKSAEASLASGAQA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgatgtcctcgaccaagactttcgaacagctgggagaaacaatgccgaaaaagtcctcc
gtcgcgatcgtcggatccggcaacatcagcaccgatctgctctacaagctgctccgctcg
gaatggcttgagccacgctggatgatcggcatcgatccggaatccgaaggtttggcgcgg
gcacgcaaactcggcctggagacatccgccgagggagtggactggctgctggcacagagc
gaaaagcctgatctggtcttcgaggccaccagtgcctacgtgcaccgtgacgccgcaccg
cgctacgaggaagcgggcattcgtgccatcgacctcacgcctgccgcggtgggtcctggt
gtcgtcccgccggccaacctgcgcgaccacctcgacgccccgaacgtcaacatggtcacg
tgcggcggtcaggcgaccatcccgatcgtgcatgccgtaagccgcgtggtcgacgtgccc
tacgccgagatcgtcgcgtcggtgtcgtcggcgtcggcaggcccgggcacgcgcgccaac
atcgacgagttcaccaagaccacgagcgccggcgtgcagaacatcggcggtgcgcagcgg
ggcaaggcgatcatcgtcctcaacccggccgaaccgccgatgatcatgcgcgacaccatc
ttctgcgccatccccgaaggcgccgaccacgacgccatcacgcagtccatcaaggacgtc
gtcgccgaggtgcagacgtacgtcccgggctaccgcctgctcaacgaaccgcagttcgac
gagccttcggtggtcaacggcggcaaccatctggtcaccacgttcgtggaagtggagggt
gcgggtgactacctgccgccctacgctggaaatctggacatcatgaccgccgcggcgacg
aaagtcggcgaggaaatcgccaagaaatcggccgaagcaagcctcgcgtcaggagcacag
gcatga

DBGET integrated database retrieval system