KEGG   Mycobacterium smegmatis MC2 155: MSMEG_6279Help
Entry
MSMEG_6279        CDS       T00434                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
msm  Mycobacterium smegmatis MC2 155
Pathway
msm03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:msm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MSMEG_6279 (recR)
DNA repair and recombination proteins [BR:msm03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     MSMEG_6279 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      MSMEG_6279 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 HHH_8 IMS_HHH zinc_ribbon_2 HHH_3
Motif
Other DBs
NCBI-GeneID: 4536974
NCBI-ProteinID: YP_890498
UniProt: A0R5R0
Position
complement(6344309..6344920)
Genome map
AA seq 203 aa AA seqDB search
MFEGPVQDLIDELGKLPGIGPKSAQRIAFHLLSVEPPDIDRLTAVLGRIRDGVTFCSVCG
NVSDEERCRICSDPRRDASLVCVVEEPKDVQAVERTREFRGRYHVLGGALDPLSGIGPEQ
LRIRELLNRIGERVEGVDVAEVIIATDPNTEGEATATYLVRMLRDIPGLTVTRIASGLPM
GGDLEFADELTLGRALAGRRAMV
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagggcccggtccaggatctgatcgacgagctgggcaagcttcccggtatcggc
cccaagagtgcccagcggatcgccttccacctgctgtcggtcgaaccgcccgacatcgac
cggctgaccgcggtgctcggacgcatccgtgacggggtcacgttctgctcggtgtgcggc
aacgtctccgacgaggaacgctgccggatctgcagcgacccgcgccgcgacgcgtcgctg
gtatgcgtcgtcgaggaacccaaggatgtgcaggcagtagaacgcacccgcgagttccgc
gggcgctaccacgtgctcggtggcgcgctcgacccgctgagcggcatcggccctgagcag
ctgcgcatccgggaactgctcaaccgcatcggcgaacgcgtcgagggcgtcgacgtcgcc
gaggtcatcatcgcgaccgatcccaacaccgagggcgaggccaccgcgacctatctggtg
cgcatgctccgcgacatccccggcctgacggtcacccgcatcgcgtcgggcctgccgatg
ggtggggatctcgagttcgccgacgagctcaccctgggccgcgcgctggccggccgccgc
gcgatggtctag

DBGET integrated database retrieval system