KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_6302
Entry
MSMEG_6302        CDS       T00434                                 

Definition
(GenBank) DNA ligase
Organism
msm  Mycolicibacterium smegmatis MC2 155
SSDB
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Other DBs
NCBI-ProteinID: ABK76125
UniProt: A0R5T2
Position
complement(6368286..6369332)
AA seq 348 aa
MDLPVQPPIEPMLAKAQVKVPDEAGVWSYEPKWDGFRALVFRDGDDVVLQSRNGKDLGRY
FPELLDALRDELVEKCVLDGEVVVPRDIAGRVRLDWESLSQRIHPAASRIKMLAEQTPAH
FIGFDALALGDRSLLKEPFRVRREALAEAVDNKRWCHVTRTSEDPALGTEWLKTFEGAGL
DGVIAKRLDGPYLPGKREMVKVKHHRDADCVAMGYRIHKSGDGIGSILLGLYRDDGELQM
VGGAASFTAKDRIKLLAELEPLREGDEMREGDPSRWNSAADKRWTPLRPEKVCEVAYDQM
EGNSVEGRRFRHAVKFLRWRPDREPSSCTFDQLDTPLNYDLYDVLEEQ
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggacttgccggtgcagcccccgatcgaaccgatgcttgccaaggcgcaggtgaaggtg
cccgacgaggcgggggtgtggtcctacgagcccaagtgggacggtttccgcgcgctggtg
ttccgcgacggtgacgacgtggtgctgcagtcgcgcaacggcaaggatctgggacggtac
tttcccgaactgctcgacgcgctgcgtgacgaactcgttgagaagtgcgtgctcgacggt
gaggtcgtggtgccccgcgacatcgccggccgggtgcggttggactgggagtcactgagc
cagcgcatccatcccgcggcgagccgcatcaagatgctcgccgagcagaccccggcgcac
ttcatcggcttcgacgccctggccctcggtgaccggtcgctgctcaaggagccgttccgg
gtgcgccgcgaggcgctggccgaggccgtcgacaacaaacggtggtgccacgtcacccgc
accagtgaggatcccgcgctgggcaccgagtggctgaagacgttcgagggcgccgggctg
gacggggtgatcgccaaacggctcgacggaccgtatctgcccggcaaacgtgagatggtc
aaggtcaagcaccaccgcgacgccgactgtgtcgcaatgggttaccgcatccacaagagc
ggcgacggcatcgggtcgatcctgctgggcctgtaccgcgacgacggggagctccagatg
gtcggcggcgcagcgtcgttcaccgccaaggatcgcatcaaactgctggccgaactcgaa
ccgctgcgcgagggcgacgagatgcgtgaaggcgaccccagccggtggaactcggcggcc
gacaagcggtggaccccgctgcgccccgagaaggtgtgcgaggtggcctacgaccagatg
gagggaaactccgtcgagggcaggcgatttcgccacgccgtgaagttcctgcgctggcgt
cccgaccgggagccgtcgagttgcacgttcgaccagttggacaccccgctgaactacgac
ctctacgacgtgctggaggaacagtga

DBGET integrated database retrieval system