KEGG   Mycolicibacterium smegmatis MC2 155: MSMEG_6427Help
Entry
MSMEG_6427        CDS       T00434                                 

Definition
(RefSeq) [Mn] superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
msm  Mycolicibacterium smegmatis MC2 155
Brite
Enzymes [BR:msm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     MSMEG_6427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 4532831
NCBI-ProteinID: YP_890640
UniProt: A0R652
Position
6496331..6496954
Genome map
AA seq 207 aa AA seqDB search
MAEYTLPDLDYDYGALEPHISGQINELHHSKHHATYVKGVNDAIAKLEEARANGDHAAIF
LNEKNLAFHLGGHINHSIWWKNLSPNGGDKPTGELAAAIDDQFGSFDKFQAQFTAAANGL
QGSGWAVLGYDSLGGRLLTFQLYDQQANVPLGIIPLLQVDMWEHAFYLQYKNVKADYVKA
FWNVVNWDDVQNRFAAATSKTSGLIFG
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaatacaccctgccggacctggattacgactatggagccctcgagccccatatc
tccggtcagatcaacgagctgcaccacagcaagcaccacgcgacctacgtcaagggtgtg
aacgacgcgattgccaagctcgaggaggcacgggccaacggtgaccacgcggccatcttc
ctgaacgagaagaacctcgcgttccatctcggtggccacatcaaccactcgatctggtgg
aagaacctctcccccaacggtggcgacaagcccaccggcgagctcgcggccgcgatcgac
gaccagttcggctcgttcgacaagttccaggcacagttcaccgctgcggccaacggcctg
cagggttcgggctgggcagtgctcggatacgacagcctcggtggccgtctgctgaccttc
cagctctacgaccagcaggccaacgtgccgctcggcatcatcccgctgctccaggtcgac
atgtgggagcacgcgttctacctgcagtacaagaacgtcaaggccgactacgtcaaggcc
ttctggaacgtcgtcaactgggatgacgtgcagaaccgcttcgcggcagccacttccaag
accagcggtctgatcttcggctga

DBGET integrated database retrieval system