KEGG   Mycobacterium smegmatis MC2 155: MSMEG_6785Help
Entry
MSMEG_6785        CDS       T00434                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K21910  L-erythrulose 1-phosphate isomerase [EC:5.3.1.33]
Organism
msm  Mycobacterium smegmatis MC2 155
Brite
Enzymes [BR:msm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.33  L-erythrulose 1-phosphate isomerase
     MSMEG_6785 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 4533146
NCBI-ProteinID: YP_890994
UniProt: A0R756
Position
complement(6833969..6834760)
Genome map
AA seq 263 aa AA seqDB search
MPDARALGAAQLWIGTSWKMNKGLAESRGYARELAEYVAAKPPAGVQPFIIPSFTALTTV
RDALGDDSPVLLGVQNAHWEDHGAWTGEVSVAQAKDAGAQIVEIGHSERREHFGETVETT
RLKVAAALHHGLVPLLCIGESAENKQAGESSRFILEQAAGALEGLTDEHLARVLIAYEPI
WAIGENGRPATVEELRQPFDDLAREYGCRTMGLLYGGSVNTDNAEDLLGIDHVTGLFIGR
AAWQLPGYVRILEMAAAHPKAKA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgacgctcgggcgctcggcgccgcacagctgtggatcggcaccagctggaagatg
aacaaggggctcgccgagtcgcgtggttacgcccgcgaactggccgagtacgtcgcggcg
aagccgccggccggcgtccagccgttcatcatcccgtcgttcaccgcactcaccacggtg
cgggacgcgctgggcgacgactcgcccgtgctgctcggggtgcagaacgcacactgggag
gaccacggcgcatggaccggtgaggtctccgtcgcgcaggcgaaggacgcaggcgcgcag
atcgtcgagatcgggcactccgagcgtcgtgagcatttcggtgagaccgtcgagaccaca
cggctcaaggtggccgcggcgctgcatcacggtctggtgccgctgctgtgcatcggcgag
agcgccgagaacaagcaggccggtgagtcgtcgcgcttcatcctcgagcaggccgcaggc
gccctggagggtttgaccgacgagcatttggcccgcgttctcattgcctacgagcccatc
tgggcgatcggcgagaacggtcgcccggcgaccgtcgaggaactgcggcagccgttcgat
gatctggcacgcgaatacggttgtcgcacaatgggattgctctacggtgggtcggtgaac
accgacaacgccgaagatctgctgggcatcgatcacgtcacggggttgttcatcggacgg
gcggcctggcagttgcccggttacgtgcggatccttgagatggccgcggctcaccccaag
gccaaggcctga

DBGET integrated database retrieval system