KEGG   Mycolicibacterium smegmatis INHR1: LI99_03895Help
Entry
LI99_03895        CDS       T03409                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
msn  Mycolicibacterium smegmatis INHR1
Pathway
msn00430  Taurine and hypotaurine metabolism
msn00620  Pyruvate metabolism
msn00640  Propanoate metabolism
msn00680  Methane metabolism
msn01100  Metabolic pathways
msn01120  Microbial metabolism in diverse environments
msn01200  Carbon metabolism
Module
msn_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:msn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LI99_03895
   00640 Propanoate metabolism
    LI99_03895
  09102 Energy metabolism
   00680 Methane metabolism
    LI99_03895
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    LI99_03895
Enzymes [BR:msn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     LI99_03895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AIU12673
Structure
PDB: 

Position
869663..870793
Genome map
AA seq 376 aa AA seqDB search
MTVLVVNSGSSSLKYAVVRPASGEFLADGIIEEIGSGAVPDHDAALRAAFDELAAAGLHL
EDLDLKAVGHRMVHGGKTFYKPSVVDDELIAKARELSPLAPLHNPPAIKGIEVARKLLPD
LPHIAVFDTAFFHDLPAPASTYAIDRELAETWHIKRYGFHGTSHEYVSQQAAIFLDRPLE
SLNQIVLHLGNGASASAVAGGKAVDTSMGLTPMEGLVMGTRSGDIDPGVIMYLWRTAGMS
VDDIESMLNRRSGVLGLGGASDFRKLRELIESGDEHAKLAYDVYIHRLRKYIGAYMAVLG
RTDVISFTAGVGENVPPVRRDALAGLGGLGIEIDDALNSAKSDEPRLISTPDSRVTVLVV
PTNEELAIARACVGVV
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgacagtactcgtcgtcaactcagggtcgtcgtcgctgaaatacgccgtggtgcggccg
gccagcggggaattcctggccgacggcatcatcgaggagatcgggtcgggcgcggtgccc
gaccatgacgccgcgttgcgcgccgcgttcgacgaactcgccgccgcgggtctccatctg
gaagacctcgatctgaaggccgtcgggcaccggatggtccacggcggcaagacgttctac
aagccgtcggtggtcgacgacgagctcatcgccaaggcgcgcgagctctccccgctggcg
ccgctgcacaacccgcccgccatcaagggcatcgaggtcgcccgcaagctgctgccggac
ctgccgcacatcgccgtgttcgacaccgcgttcttccacgacctgcccgcgcccgcgagc
acctacgccatcgaccgcgaactcgccgagacgtggcacatcaagcgctacggttttcat
ggcacgtcgcacgagtacgtcagccagcaggccgcgatcttcctcgaccgtccgctggaa
tcgctgaatcagattgtgctgcacctgggtaacggtgcctcggcaagcgccgtggcaggt
ggtaaggccgtcgacacgtcgatgggtctgaccccgatggagggcctggtgatgggcacg
cgcagcggtgacatcgaccccggggtcatcatgtacctgtggcgcaccgcgggcatgagc
gtcgacgacatcgagtcgatgctcaaccggcgctccggggtcctcggtctcggtggcgcc
agcgacttccgcaagcttcgtgagctcatcgaatccggggatgagcacgcgaaactggcg
tacgacgtctacatccaccgactgcgcaagtacatcggcgcgtacatggccgtgctcggc
aggaccgacgtgatcagcttcaccgccggggtgggcgagaacgtccccccggtgcggcgc
gatgcgttggccgggctgggcggtctgggcatcgagatcgatgatgcgctgaactccgcg
aaatccgatgagccccggctcatctcgaccccggattcgcgtgtgaccgtgctcgtggtg
cccaccaacgaggaactcgcgatcgcccgtgcgtgtgtgggcgtggtgtag

DBGET integrated database retrieval system