KEGG   Mycolicibacterium smegmatis INHR1: LI99_23985
Entry
LI99_23985        CDS       T03409                                 

Definition
(GenBank) 3-ketoacyl-ACP reductase
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
msn  Mycolicibacterium smegmatis INHR1
Pathway
msn00903  Limonene and pinene degradation
msn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msn00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LI99_23985
Enzymes [BR:msn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     LI99_23985
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Pterin_bind
Other DBs
NCBI-ProteinID: AIU16520
UniProt: A0A0D6IU78
Position
4943432..4944277
AA seq 281 aa
MSGRVEGKVAFVTGAARGQGRSHALRLAQEGADIIAIDICGPIRPGAETAIPASTSDDLA
ETANLVKGLDRRVVTAEVDVRDAAAIKAAVDSGVEQLGRLDIIVANAGIGNGGDTLDQTS
EEDWDEMIDINLSGVWKSVKAGVPHIVAGGRGGSIVLTSSVGGLKAYPHCGNYVAAKHGV
VGLMRGFAVELGQHNIRVNTVHPTHVATPMLHNEGTFKMFRPDLENPGPDDMAPICQMFH
TLPIPWVEPIDISNAVLFLASDEARYITGVTLPVDAGSCLK
NT seq 846 nt   +upstreamnt  +downstreamnt
atgtctggacgggtggaaggcaaggtcgcattcgtcaccggcgcggcccgcggccagggc
cgtagtcacgcactgcggttggcgcaggaaggcgccgacatcatcgccatcgacatctgc
ggccccattcgccccggcgccgaaaccgccatcccggcatcgacatccgatgaccttgcc
gagaccgcgaacctggtgaagggactcgaccgccgcgtcgtcaccgcggaggtggacgtg
cgcgacgccgcggccatcaaggccgctgtcgacagcggtgtcgagcagctcggcaggctc
gacatcatcgtcgccaacgccggcatcggcaacggcggcgacaccctcgaccagacctcc
gaggaggactgggacgagatgatcgacatcaatctgtccggtgtctggaagtctgtgaaa
gccggtgtcccccatatcgtcgcgggcggacgcggcgggtcgatcgtcctgaccagttcg
gtaggcgggctgaaggcctatccgcactgcggcaactacgtggccgccaagcacggcgtg
gtgggcctcatgcggggcttcgcagtggaactcgggcagcacaacatccgcgtcaacacc
gtgcacccgacgcacgtcgccaccccgatgctgcacaacgagggcaccttcaagatgttc
cgtcccgacctggagaacccgggccccgacgacatggcccccatctgccagatgttccac
acgttgcccatcccgtgggtcgagcccatcgacatcagcaacgccgtgctgttcctggcc
tccgacgaggcccgttacatcacgggcgtgacgttgccggtcgacgcgggaagctgcctc
aagtag

DBGET integrated database retrieval system