KEGG   Mycolicibacterium smegmatis INHR1: LI99_24335Help
Entry
LI99_24335        CDS       T03409                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msn  Mycolicibacterium smegmatis INHR1
Pathway
msn00071  Fatty acid degradation
msn00072  Synthesis and degradation of ketone bodies
msn00280  Valine, leucine and isoleucine degradation
msn00310  Lysine degradation
msn00362  Benzoate degradation
msn00380  Tryptophan metabolism
msn00620  Pyruvate metabolism
msn00630  Glyoxylate and dicarboxylate metabolism
msn00640  Propanoate metabolism
msn00650  Butanoate metabolism
msn00900  Terpenoid backbone biosynthesis
msn01100  Metabolic pathways
msn01110  Biosynthesis of secondary metabolites
msn01120  Microbial metabolism in diverse environments
msn01130  Biosynthesis of antibiotics
msn01200  Carbon metabolism
msn01212  Fatty acid metabolism
msn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LI99_24335
   00630 Glyoxylate and dicarboxylate metabolism
    LI99_24335
   00640 Propanoate metabolism
    LI99_24335
   00650 Butanoate metabolism
    LI99_24335
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LI99_24335
   00072 Synthesis and degradation of ketone bodies
    LI99_24335
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LI99_24335
   00310 Lysine degradation
    LI99_24335
   00380 Tryptophan metabolism
    LI99_24335
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LI99_24335
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LI99_24335
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LI99_24335
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msn04147]
    LI99_24335
Enzymes [BR:msn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LI99_24335
Exosome [BR:msn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LI99_24335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt DbpA
Motif
Other DBs
NCBI-ProteinID: AIU16589
UniProt: A0A0D6IU35
Position
complement(5015471..5016649)
Genome map
AA seq 392 aa AA seqDB search
MTTSVIVAGARTPVGKLMGSLKDFSGTDLGAIAIRAALEKANVPASMVEYVIMGQVLTAG
AGQMPARQAAVAAGIPWDVAALSINKMCLSGIDAIALADQLIRAGEFDVIVAGGQESMSQ
APHLLPKSREGYKYGDATLVDHLAYDGLHDVFTDQPMGALTEQRNDVDKFTRAEQDEYAA
QSHQKAAAAWKDGVFADEVVPVSIPQRKGDPIEFAEDEGIRANTTAESLAGLKPAFRKDG
TITAGSASQISDGAAAVIVMNKAKAEELGLTWLAEIGAHGVVAGPDSTLQSQPANAIKKA
ITREGITVDQLDVIEINEAFAAVALASTKELGVDPAKVNVNGGAIAIGHPIGMSGARIAL
HAALELARRGSGYAVAALCGAGGQGDALVLRR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgtcggtgatcgttgctggagcgcgtacaccagtcggtaagttgatgggttcg
ctcaaggatttctccggcaccgatcttggcgccatcgcgatccgcgcggctctcgaaaag
gccaacgtacctgcatcgatggtggagtacgtgatcatgggtcaggtgctcacggcgggc
gcgggccagatgcccgcgcgtcaggccgcggtggccgccggtatcccgtgggatgtcgct
gcgctgagcatcaacaagatgtgcctgtcgggcatcgacgcgatcgcactcgccgaccag
ttgatccgcgctggtgaattcgacgtcatcgtcgcaggtggccaggaatcgatgagccag
gccccgcacctgttgcccaagagccgcgagggctacaagtacggcgacgccaccctggtc
gatcacctcgcctacgacggtctgcacgacgtgttcaccgatcagcccatgggtgcgctc
accgagcagcgcaacgatgtcgacaagttcacgcgcgccgagcaggacgagtacgccgcg
cagtcgcaccagaaggccgccgcggcgtggaaggacggcgtcttcgccgacgaggtcgtt
ccggtgtccatcccgcagcgcaagggtgacccgatcgagttcgccgaggacgagggcatc
cgcgccaacaccaccgccgagtcgctcgcggggctgaagcccgcgttccgcaaggacggc
accatcacggccggttcggcgtcgcagatctccgacggggctgccgccgtgatcgtgatg
aacaaggccaaggccgaggagctgggtctgacctggctcgccgagatcggcgcgcacggc
gtcgtcgccggccccgactcgacgctgcagtcgcagccggccaacgcgatcaagaaggcc
atcacgcgcgagggcatcacggtcgatcagctcgatgtcatcgagatcaacgaggcgttc
gcggccgtcgcgctcgcctcgaccaaggaactcggcgtcgacccggccaaggtgaacgtc
aacggtggcgccatcgccatcggccacccgatcggcatgtccggtgcgcgcatcgcgctg
cacgccgcgctcgagctcgcgcgccgcggttccgggtacgcggtcgcggccctgtgcggt
gccggcggtcagggcgacgccctggtcctgcgtcgctga

DBGET integrated database retrieval system