KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_03210Help
Entry
Mspyr1_03210      CDS       T01376                                 

Definition
(GenBank) arylamine N-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00633  Nitrotoluene degradation
msp01100  Metabolic pathways
msp01110  Biosynthesis of secondary metabolites
msp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:msp00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Mspyr1_03210
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mspyr1_03210
Enzymes [BR:msp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     Mspyr1_03210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: ADT97035
UniProt: E6TKT5
Position
327129..327956
Genome map
AA seq 275 aa AA seqDB search
MSRLSDAYLSRIGFSGPAAATVDTLRRIVAAHNAAIPFENLDPLMGVPVVDLSAEALSDK
LIGRRRGGYCYEHNGLLGYVLEDLGYAVERLVGRVVWMHEGDALPAQTHQVLAVTLPDGD
GPWLVDVGFGGQTLTSPIRLQTGVVAQTRHEPYRLLDHAHGMQLQALIRDVWQPLYLLDP
APRPRIDLEVGSWYVSTFPRSGFVTGLTAALVTDDARWNLRGRHLAVHRAGGTEKTRLDT
AAEVMELLATRFGIDLDDLGNRADVASRITAVLDT
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgtctgtccgacgcgtatctctcccgtatcgggttctccggtcccgctgccgcg
accgtcgacaccctgcggcgcatcgtcgccgcccacaatgccgccatcccgttcgagaac
ctcgatccgctgatgggggtcccggtggtcgatctgtcggcagaagcgttgtcggacaag
ctcatcggtcggcgccgcggcggctactgctacgaacacaacggattgctcggctacgtc
ctcgaagatctcggctacgcggtggaacgtctcgtcggccgcgtcgtctggatgcacgaa
ggtgacgccctccccgcccagacccatcaggtgctggcggtgacgctgccggacggcgac
gggccctggctcgtcgacgtcggattcggcggccagacactgacgtcgccgatccggttg
cagaccggcgtcgtcgcccagacccggcacgagccctaccggctgctcgaccacgcccac
gggatgcagctgcaggccttgatccgcgatgtctggcagccgctgtacctgctcgacccg
gccccccgcccgcggatcgacctcgaggtgggcagctggtacgtgtcgacgttcccgcgg
tcgggcttcgtcaccgggctcaccgccgcgctggtcaccgacgacgcccgctggaacctg
cgcggcaggcatctcgccgtgcaccgcgcgggcggcacggagaagacccgcctggacacc
gcggccgaggtgatggagttgcttgcgacgcgattcgggatcgacctggacgatctcgga
aaccgtgccgacgtggcgtcgcgcatcaccgccgtcctcgacacctga

DBGET integrated database retrieval system