KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_03430Help
Entry
Mspyr1_03430      CDS       T01376                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00071  Fatty acid degradation
msp00072  Synthesis and degradation of ketone bodies
msp00280  Valine, leucine and isoleucine degradation
msp00310  Lysine degradation
msp00362  Benzoate degradation
msp00380  Tryptophan metabolism
msp00620  Pyruvate metabolism
msp00630  Glyoxylate and dicarboxylate metabolism
msp00640  Propanoate metabolism
msp00650  Butanoate metabolism
msp00900  Terpenoid backbone biosynthesis
msp01100  Metabolic pathways
msp01110  Biosynthesis of secondary metabolites
msp01120  Microbial metabolism in diverse environments
msp01130  Biosynthesis of antibiotics
msp01200  Carbon metabolism
msp01212  Fatty acid metabolism
msp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mspyr1_03430
   00630 Glyoxylate and dicarboxylate metabolism
    Mspyr1_03430
   00640 Propanoate metabolism
    Mspyr1_03430
   00650 Butanoate metabolism
    Mspyr1_03430
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mspyr1_03430
   00072 Synthesis and degradation of ketone bodies
    Mspyr1_03430
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mspyr1_03430
   00310 Lysine degradation
    Mspyr1_03430
   00380 Tryptophan metabolism
    Mspyr1_03430
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mspyr1_03430
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mspyr1_03430
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mspyr1_03430
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msp04147]
    Mspyr1_03430
Enzymes [BR:msp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mspyr1_03430
Exosome [BR:msp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mspyr1_03430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADT97057
UniProt: E6TKV7
Position
351834..353135
Genome map
AA seq 433 aa AA seqDB search
MADSKTARRVAILGGNRIPFARSDGAYAQASNQDMFTAVLDGLADRFNLKGEKLDAVIGG
AVLKHSRDFNLMRECVLGSSLSSYTPAFDLQQACGTGLQSAIAAADGIARGRYDVAAAGG
VDTASDAPIAFGDDLRKVLLGLRRAKSNVDRLKLVGKLPASLGVEIPVNSEPRTGMSMGE
HAAVTAKEMGVKRVDQDELAAASHRNMSAAYDRGFFDDLVSPFLGLYRDNNLRPDSSAEK
LAKLKPVFGVRNGDATMTAGNSTPLTDGASVALLSSEEWAAQHSIPVLAYLVDAETAAVD
YVNGRDGLLMAPTYAVPRLLTRNGLTLQDFDYYEIHEAFASVVLATLAAWESDEYCKERL
GLDKALGSIDRSKLNVNGSSLAAGHPFAATGGRIVAQLAKQLAEKKKQTGQPVRGLISVC
AAGGQGVTAILEA
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
gtggcagacagcaagacagcgcgccgggtggcgattctcggaggtaaccggatcccgttc
gcccgctccgacggcgcctacgcgcaagcgtccaaccaggacatgttcaccgccgtgctg
gacgggctggcagaccgcttcaacctcaagggcgaaaagctcgacgccgtcatcggcggc
gccgtcctcaagcacagccgggacttcaacctgatgcgcgaatgcgtgctgggcagctcg
ttgtcgtcgtacacgcccgcgttcgacctgcagcaggcctgcgggacgggcctgcagtcg
gcgatcgcggcggccgatggcatcgcccgggggcgctacgacgtggcggcggccgggggt
gtcgacaccgcctccgacgccccgatcgcgttcggcgacgacctgcgcaaggtcctgctc
gggttgcgccgcgccaagtccaacgtcgaccgcctcaagctggtgggcaagctgcccgca
tcgctgggcgtcgagatccccgtcaacagcgaaccgcgcacgggcatgtcgatgggcgag
cacgccgccgtcaccgccaaggagatgggcgtcaagcgcgtcgaccaggacgagctcgcc
gcggccagccaccgcaacatgtccgccgcctacgaccgcgggttcttcgacgacctggtc
agcccgttcctggggctgtaccgggacaacaatctgcgccccgattcttccgcggagaag
ctggccaagctcaagccggtcttcggcgtgcgcaacggcgacgccacgatgaccgcgggc
aactccaccccgctgaccgacggcgcgtcggtggcgctgctgtcgtcggaggagtgggcc
gcgcagcactcgatcccggtgctcgcgtatctcgtcgacgccgagaccgcggcggtcgat
tacgtcaacggccgcgacggcctgctgatggcgccgacgtacgcggtgccgcggctgctc
acccgcaacggcctgaccctgcaggacttcgactactacgagatccacgaggcgttcgcg
tccgtcgtgctcgcgacgctggccgcgtgggagtccgacgagtactgcaaggagcgtctg
ggactggacaaggcgctgggatcgatcgatcgttccaagctcaacgtgaacggctcgtcg
ctggccgccgggcatccgttcgcggccaccggcggccggatcgtcgcccagctggccaag
cagctcgccgagaagaagaagcaaaccggtcagccggtgcgggggctgatctccgtctgc
gccgccggcggccagggcgtaacggccatcctggaggcctag

DBGET integrated database retrieval system