KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_06580Help
Entry
Mspyr1_06580      CDS       T01376                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:msp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Mspyr1_06580
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Mspyr1_06580
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Mspyr1_06580
    1.1.1.-  
     Mspyr1_06580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ADT97362
UniProt: E6TB20
Position
676333..677385
Genome map
AA seq 350 aa AA seqDB search
MRAAVYYGPNKLEVDDVPEPEARPGTVKLKVGFNGICGTDLHEYYAGPIFVPTAPHPLTG
AQLPLTMGHEFSGTITAVGDGVTGWREGDRVAVEPIYKCDQCGPCRAGNYNVCQQIGFHG
LMSDGGMAEYTVVPTGMLHRLPDTVSLELGALVEPMSVAYHAATLGEVSAGDTAMVFGAG
PIGIGLWFALRGKGLDDVFVVEPSPTRRTAIEALGARTLDPTADDVPAFIADHTGGDGAD
AVFDAAGVTPAVATALGCVGSRKPMISVAIYEKPLETPLLNLVMNESRIQGSLCYTGADF
ESVIALMADGRYDTTGWVTRIPIDDVVDEGFEALHAGTKMKVLVDPNGAQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagagcagctgtctactacggaccgaacaaactcgaggtcgacgacgtgccagaaccc
gaggctcgacccgggacggtcaagctgaaggtcggcttcaacggcatctgcggaaccgac
ctgcacgagtactacgcgggcccgatcttcgtgccgacggcgccgcatcccctgaccggc
gcgcagctgccgctgacgatgggccacgagttctccggcacgatcaccgcggtcggcgac
ggcgtcaccgggtggcgggagggcgatcgtgtggcggtcgagccgatctacaagtgcgat
cagtgcggcccgtgccgggccggcaactacaacgtctgccagcagatcggctttcacggc
ctgatgtccgacggcggcatggccgaatacaccgtggtgccgacgggcatgctgcaccgg
ctgcccgacaccgtgtcgctggagctcggcgcgctggtcgagccgatgtcggtggcctat
cacgccgccaccctcggcgaggtcagcgccggtgacacggccatggtgttcggcgccggc
cccatcgggatcggcctgtggttcgcgttgcgcggcaaagggcttgacgacgtgttcgtg
gtggagccgtcaccgacccgccgcaccgcgatcgaagcgctcggggccaggaccctcgac
ccgacagccgacgacgtgccggccttcatcgccgaccatacgggcggcgatggcgccgac
gcggtgttcgacgccgccggcgtgacaccggcggtcgccaccgcgctgggctgcgtcggg
tcccgaaagccgatgatcagcgtcgccatctacgaaaaacccttggagacaccgcttctg
aatctcgtgatgaacgagtcgaggatccagggctcgctgtgttacaccggcgccgacttc
gagtcggtgatcgcgctgatggccgacggccgatacgacaccaccggctgggtcacccgg
atcccgatcgacgacgtggtcgacgagggcttcgaagcgttgcacgccggcacgaagatg
aaggttctcgtcgatccgaacggagcgcaatag

DBGET integrated database retrieval system