KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_06760Help
Entry
Mspyr1_06760      CDS       T01376                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00630  Glyoxylate and dicarboxylate metabolism
msp01100  Metabolic pathways
msp01110  Biosynthesis of secondary metabolites
msp01120  Microbial metabolism in diverse environments
msp01200  Carbon metabolism
Module
msp_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Mspyr1_06760
Enzymes [BR:msp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Mspyr1_06760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADT97380
UniProt: E6TB38
Position
692752..694038
Genome map
AA seq 428 aa AA seqDB search
MSTVGMPKSPEQIQHDWDHNPRWKGITRTYTPADVVALQGHVVEEHTLARRGAEVLWEQL
HDMDFVNSLGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
IRRINNALLRADEIAKVEGDTSVENWLAPIVADGEAGFGGALNVYELQKAMIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVAGVPTVVIARTDAEAATLITSD
VDERDQPFITGDRTAEGFYRVKNGLEPCIARAKAYAPYSDLIWMETGTPDLELAKKFAEG
VKSEFPDQMLAYNCSPSFNWKQHLDDATIAKFQKELGAMGFKFQFITLAGFHALNYSMFD
LAYGYARNQMSAYVELQEREFAAEERGYTATKHQREVGAGYFDRIATTVDPTSSTTALAG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgttggcatgccgaagagcccggaacagatccagcacgactgggaccacaac
ccccgctggaagggcatcacccgcacctacaccccggccgatgtcgtcgccctgcagggc
cacgtcgtcgaggagcacaccctggcccgccgcggcgccgaggtgctgtgggagcagctg
cacgacatggacttcgtcaactccctcggtgccctgaccggcaacatggccgtccagcag
gtccgcgccggcctgaaggccatctacctgtcgggttggcaggtcgccggcgacgcgaac
ctctccggccacacctacccggatcagagcctctacccggccaactcggtgccccaggtc
atccgtcgcatcaacaacgcgctgctgcgcgccgatgagatcgccaaggtggagggtgac
acctccgtcgagaactggctggccccgatcgtcgccgacggcgaggccggtttcggtggc
gcgctgaacgtctacgagctgcagaaggcgatgatcgccgccggtgtcgccggctcgcac
tgggaggaccagctggcctcggagaagaagtgcggccacctcggtggcaaggtgctgatc
ccgacccagcagcacatccgcaccctgacctcggcccgcctggccgccgacgtcgccggc
gtgccgaccgtcgtcatcgcccgcaccgacgccgaggccgccacgctcatcacctccgac
gtcgacgagcgcgatcagccgttcatcaccggtgaccgcaccgccgagggcttctaccgc
gtgaagaacggcctcgagccctgcatcgcgcgcgccaaggcgtacgcgccgtactccgat
ctgatctggatggagaccggcaccccggatctggagctggcgaagaagttcgccgagggc
gtcaagagcgagttcccggaccagatgctggcctataactgctcgccgtcgttcaactgg
aagcagcatctcgacgacgcgacgatcgcgaagttccagaaggagctcggcgcgatgggc
ttcaagttccagttcatcaccctcgccggcttccacgccctgaactactcgatgttcgat
ctggcctacggttacgcccgcaaccagatgagcgcctacgtcgagctgcaggagcgcgag
ttcgccgccgaggagcgcggctacaccgcgaccaagcaccagcgtgaggtcggcgccggc
tacttcgaccggatcgccaccaccgtggatccgaccagctcgaccaccgcgctcgcgggc
tcgaccgaagagggccagttccactga

DBGET integrated database retrieval system