KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_10740Help
Entry
Mspyr1_10740      CDS       T01376                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase; short chain enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00071  Fatty acid degradation
msp00280  Valine, leucine and isoleucine degradation
msp00281  Geraniol degradation
msp00310  Lysine degradation
msp00362  Benzoate degradation
msp00380  Tryptophan metabolism
msp00410  beta-Alanine metabolism
msp00640  Propanoate metabolism
msp00650  Butanoate metabolism
msp00903  Limonene and pinene degradation
msp00930  Caprolactam degradation
msp01040  Biosynthesis of unsaturated fatty acids
msp01100  Metabolic pathways
msp01110  Biosynthesis of secondary metabolites
msp01120  Microbial metabolism in diverse environments
msp01130  Biosynthesis of antibiotics
msp01200  Carbon metabolism
msp01212  Fatty acid metabolism
Module
msp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mspyr1_10740
   00650 Butanoate metabolism
    Mspyr1_10740
  Lipid metabolism
   00071 Fatty acid degradation
    Mspyr1_10740
   01040 Biosynthesis of unsaturated fatty acids
    Mspyr1_10740
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mspyr1_10740
   00310 Lysine degradation
    Mspyr1_10740
   00380 Tryptophan metabolism
    Mspyr1_10740
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mspyr1_10740
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mspyr1_10740
   00281 Geraniol degradation
    Mspyr1_10740
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mspyr1_10740
   00930 Caprolactam degradation
    Mspyr1_10740
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Mspyr1_10740
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mspyr1_10740
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Mspyr1_10740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored NAD_binding_8 AlaDh_PNT_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ADT97759
UniProt: E6TFA6
Position
1085629..1087779
Genome map
AA seq 716 aa AA seqDB search
MAENTIKWDKDADGIVTLTLDDPTGSANVMNEHYKASMHDAVERLAAEKDSVTGVVIASA
KKTFFAGGDLKGMMNVGPDNAAESFAEVEFIKADLRKLETLGVPVVAAINGAALGGGLEI
ALACHHRIAADTRGVVIGLPEVTLGLLPGGGGVARTVRMFGIQKAFMEILSQGTRFKPGK
AKEIGLVDELVDSVEELVPAAKAWIKANPEAHTQPWDQKGYKMPGGTPSSPGLASILPSF
PALLKKQLKGAPMPAPRAILDAAVEGAQVDFDTATRIESRYFVGLVTGQTAKNMIQAFFL
DLQAINGGASRPDGIAKQEIKKIGVLGAGMMGAGIAYVSAKAGYDVVLKDVSIEAAQKGK
AYSEKIEAKALERGRTTEEKSDALLARITPAADAADLKGVDFVIEAVFENQELKHKVFQE
IEDIVEPNALLGSNTSTLPITGLATGVKRQEDFIGIHFFSPVDKMPLVEIIKGEKTSDEA
LARVFDYTLAIGKTPIVVNDSRGFFTSRVIGTFVNEALAMLGEGVPAASIEQAGAQAGYP
AAPLQLSDELNLELMQKIATETRKATEAAGGTHVAHPAEEVVNKMIEIGRPSRLKGAGFY
EYVDGKRVGLWPGLADTFGSGGAVDIPLQDMIDRMLFAEALETQKCLDEGVLTSTADANI
GSIMGIGFPPYTGGSAQFIVGYQGELGVGKEAFVARAKQLAERYGERFNPPASLTS
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaacaccatcaagtgggacaaggatgccgacggcatcgtcaccctgacgctg
gacgacccgaccgggtcggccaacgtgatgaacgagcactacaaggcttcgatgcatgac
gccgtcgaacgccttgccgccgagaaggattcggtcaccggtgtggtgatcgccagcgcg
aagaagaccttcttcgccggcggtgacctcaagggcatgatgaacgtcggccccgacaac
gcggcggagtccttcgccgaggtcgagttcatcaaggccgacctgcgcaagctggagacc
ctcggtgtacccgtcgtcgcagccatcaacggcgccgccctcggcggcggcctggagatc
gcgctggcgtgtcaccaccgcatcgccgccgacacccgcggtgtcgtgatcggcctgccc
gaggtcaccctcgggctgctgcccggcggcggtggcgtggcccgcaccgtgcggatgttc
ggtatccagaaggcgttcatggagatcctgtcgcagggaacgcgtttcaagccgggcaag
gccaaggagatcggtctggtcgacgagttggtcgacagcgtcgaggaactcgtccccgcc
gccaaggcgtggatcaaagcgaatccggaagcccacacccagccgtgggatcagaagggc
tacaagatgcccggcggcacgccgagcagccccggcctggcgtcgatcctgccgtccttc
ccggcactgctgaagaagcagctcaagggtgccccgatgccggccccgcgcgcgatcctc
gacgccgccgtcgaaggcgcccaggtcgacttcgacaccgccacccgtatcgagagccgc
tacttcgtcggcctggtcaccggccagaccgcgaagaacatgatccaggccttcttcctg
gatctgcaggccatcaacggcggcgcctcgcggcccgacggtatcgccaagcaggagatc
aagaagatcggtgtgctcggcgcgggcatgatgggcgccggtatcgcctacgtgtcggcc
aaggccggctatgacgttgtcctgaaggatgtttcgatcgaagcggcccagaagggcaag
gcgtactcggagaagatcgaggccaaggcgctcgaacgtgggcgcacgaccgaggagaag
tccgacgctctgttggcccggatcacccccgccgccgacgccgccgatctcaagggcgtc
gacttcgtgatcgaggccgtcttcgagaaccaggaactcaagcacaaggtgttccaggag
atcgaggacatcgtcgagccgaacgcgctgctgggctcgaacacctccacgctgccgatc
accggtctggcgaccggcgtgaagcgccaggaggacttcatcgggatccacttcttctca
cccgtcgacaagatgccgctggtggagatcatcaagggcgagaagacctctgacgaggca
ctggcccgggtgttcgactacacgctcgcgatcggcaagaccccgatcgtggtcaacgac
agccgtgggttcttcacctcccgcgtcatcggcacgttcgtcaacgaggcgttggcgatg
ctcggcgagggcgtgccggcggccagcatcgagcaggcgggtgcgcaggccggctacccg
gcggcgccgctgcagctctccgacgagctcaacctggagctcatgcagaagatcgccacc
gagacccgcaaggcgaccgaggcggccggcggcacccacgtggcgcacccggccgaggag
gtcgtcaacaagatgatcgagatcggtcgtccgtcgcggctcaagggtgcgggcttctac
gagtacgtcgacggcaagcgcgtcggcctgtggccgggtctcgccgacacgttcggctcc
ggcggcgcggtcgatatcccgttgcaggacatgatcgaccgcatgctgttcgccgaggcg
ctggagacccagaagtgcctcgacgaaggcgtgctcacctcgaccgccgacgccaacatc
ggctccatcatgggtatcggcttcccgccgtacaccggtggttcggcgcagttcatcgtc
ggctaccagggcgagctcggtgtcggtaaggaggcgttcgtcgcgcgggccaagcagttg
gccgagcgctacggcgagcggttcaacccgccagcctcgctgacgtcctaa

DBGET integrated database retrieval system