KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_12650Help
Entry
Mspyr1_12650      CDS       T01376                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00020  Citrate cycle (TCA cycle)
msp00640  Propanoate metabolism
msp00660  C5-Branched dibasic acid metabolism
msp01100  Metabolic pathways
msp01110  Biosynthesis of secondary metabolites
msp01120  Microbial metabolism in diverse environments
msp01130  Biosynthesis of antibiotics
msp01200  Carbon metabolism
Module
msp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mspyr1_12650
   00640 Propanoate metabolism
    Mspyr1_12650
   00660 C5-Branched dibasic acid metabolism
    Mspyr1_12650
Enzymes [BR:msp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mspyr1_12650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADT97945
UniProt: E6THZ8
Position
1289457..1290620
Genome map
AA seq 387 aa AA seqDB search
MDLFEYQAKELFAKHNVPTTPGRVTDSAEDAKAIATEIGKPVMVKAQVKVGGRGKAGGVK
YAATPDDAFTHAQNILGLDIKGHVVKKLLVAEASDIAEEYYISFLLDRSNRTYLAMCSVE
GGMEIEEVAATKPDRLAKVPVNAVKGVDLAFAREIAEKGHLPAEVLDAAAVTIQKLWEVF
TKEDATLVEVNPLVRTPDDQILALDGKVTLDANADFRQEGHKEFEDKDATDPLELKAKEN
DLNYVKLDGEVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMANGLD
VILNDSQVKSVFVNVFGGITSCDAVANGIVKALEILGDEANKPLVVRLDGNNVDEGRRIL
AEANHPLVVQAETMDSGADKAAELANK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggacctcttcgagtatcaggcgaaagagctcttcgcgaagcacaacgttcccaccacg
cccggccgcgtcaccgactctgccgaggacgcgaaggccatcgccaccgagatcggcaag
cccgtcatggtcaaggcgcaggtcaaggtcggcggccgtggcaaggccggtggcgtgaag
tacgccgccaccccggacgacgcgttcacccacgcacagaacatcctgggcctcgacatc
aagggccacgtcgtcaagaagctgctcgtcgccgaggccagcgacatcgccgaggagtac
tacatctccttcctgctcgaccgctccaaccgcacctacctggccatgtgctcggtcgag
ggcggcatggagatcgaagaggtcgccgcgaccaagcccgaccgcctcgccaaggtgccc
gtcaacgccgtcaagggtgtcgacctcgccttcgcccgggagatcgccgagaagggccac
ctgcccgccgaggtgctcgacgcggcggccgtgacgatccagaagctctgggaggtgttc
acgaaggaggacgccaccctggtcgaggtgaacccgctcgtgcgtacgccggacgaccag
atcctggcgctggacggcaaggtcaccctggacgcgaacgcggacttccgccaggagggc
cacaaggagttcgaggacaaggacgccacggatccgctggaactcaaggccaaggagaac
gacctcaactacgtcaagctcgacggtgaggtcggcatcatcggcaacggcgcgggcctg
gtcatgtcgaccctcgacgtggtcgcctacgccggtgagaagcacggcggcgtgaagccg
gccaacttcctcgacatcggtggtggcgcgtcggccgaggtgatggccaacgggctcgac
gtgatcctgaacgacagccaggtcaagagcgtgttcgtcaacgtcttcggtggcatcacg
tcctgcgacgcggtcgccaacggcatcgtcaaggcgctggagatcctcggcgacgaggcc
aacaagcctctggtcgtccgcctcgacggcaacaacgtcgacgagggccgtcgcatcctt
gccgaggccaaccacccgttggtcgtgcaggcagaaaccatggactccggggccgacaag
gccgccgagctggccaacaagtag

DBGET integrated database retrieval system