KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_16230Help
Entry
Mspyr1_16230      CDS       T01376                                 

Definition
(GenBank) glycogen synthase
  KO
K16148  alpha-maltose-1-phosphate synthase [EC:2.4.1.342]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00500  Starch and sucrose metabolism
msp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mspyr1_16230
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:msp01003]
    Mspyr1_16230
Enzymes [BR:msp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.342  alpha-maltose-1-phosphate synthase
     Mspyr1_16230
Glycosyltransferases [BR:msp01003]
 Polysaccharide
  Storage polysaccharide
   Mspyr1_16230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_transf_5 GGDEF_2
Motif
Other DBs
NCBI-ProteinID: ADT98290
UniProt: E6TMY7
Position
complement(1642295..1643443)
Genome map
AA seq 382 aa AA seqDB search
MTREYPPEVYGGAGVHVTELVAQLRRLCEVDVHCMGAPRPDAMVAATDPALAGANPALTT
LSADLNMVNAAAQAQVVHSHTWYAGMAGHLSALLYGVPHVLTAHSLEPMRPWKAEQLGGG
YRISSWVEKTAVEAADAVIAVSAGMREDVLHAYPTLDPSRVHVVLNGIDTDKWRPVDAGG
DESVLTELGVDLSRPIVAFVGRITRQKGVAHLVAAAHHFDPGIQLVLCAGAPDTPEIAEE
VASAVQRLAEARTGVFWVREMLPQPKIDEILSAATTFVCPSVYEPLGIVNLEAMACATAV
VASDVGGIPEVVADGQTGLLVHYDAKDTATFERQLAEAVNSLVADPQRAREYGVAGRQRC
IDEFSWARIAEQTLQIYRSVTA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgggagtatccaccggaggtctacggcggcgccggcgtccacgtcaccgagctc
gtcgcgcagctgcgacgactctgtgaggtcgatgtgcactgcatgggcgcgccacgcccc
gatgccatggtcgcggctaccgacccggcgctggcgggcgccaacccggccctgaccacg
ctgtcggcggacctcaacatggtcaacgcggcggcgcaggcccaggtcgtgcactcccac
acctggtatgccggaatggccgggcacctttcggcgctgctctacggagtgccgcatgtg
ctcaccgcgcactcgctggagccgatgcggccgtggaaggccgaacaactcggcgggggc
taccgcatctcgtcctgggtggagaagacggccgtggaggccgccgacgcggtgatcgcc
gtcagtgccggcatgcgggaggacgtgctgcacgcctacccgacactcgatccgagcagg
gtgcatgtcgttctcaacggcatcgacaccgacaagtggcgtccggtcgacgccggcggc
gacgaatcggtgctgaccgaactcggcgtcgacctgtcccgtccgatcgtcgcgttcgtc
ggacggatcacccggcagaagggcgtcgcccatctggtcgccgccgcgcaccatttcgat
cccggcattcagctggtgctgtgcgccggcgcccccgacaccccggagatcgccgaggag
gtggcctccgcggtgcagcgtctcgccgaggcacgcacgggcgtgttctgggtgcgggag
atgctgccacagcccaagatcgacgagatcctgtcagcggcaacgacgttcgtgtgcccg
tcggtctacgagccgctcggcatcgtgaacctggaggcgatggcctgcgcgacggcggtc
gtcgcgtccgacgtcggcggcattcccgaggtggtggccgacgggcagacaggtctgctg
gtgcactacgacgcgaaggacaccgcgacgttcgagcgccagctcgccgaagccgtcaac
agtctcgtcgcggatccacagcgggcccgcgagtacggggtggccggacggcagcggtgc
atcgacgagttctcgtgggcgcgcatcgccgagcagaccctgcagatctaccggtccgtc
acggcctag

DBGET integrated database retrieval system