KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_18560
Entry
Mspyr1_18560      CDS       T01376                                 

Definition
(GenBank) dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00903  Limonene and pinene degradation
msp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mspyr1_18560
Enzymes [BR:msp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     Mspyr1_18560
SSDB
Motif
Pfam: adh_short_C2 adh_short KR
Other DBs
NCBI-ProteinID: ADT98517
UniProt: E6TBC1
Position
complement(1892063..1892899)
AA seq 278 aa
MAGRVEGKVAFITGAARGQGRAHAVRLAEEGADIIAVDICKQIDSVLIPLSTPEDLAETA
DLVKNAGGRIHTAEVDVRDYDALKAAVDAGVEEFGRLDIIVANAGIGNGGQTLDKTDEPD
WDDMIGVNLSGVWKTVKAGVPHILAGGNGGSIILTSSVGGLKAYPHTGHYVAAKHGVVGL
MRTFAVELGAQNIRVNSVHPTNVNTPLFMNEPTMKLFRPDLENPGPDDMKVVGQLMHTLP
IGWVEPEDIANAVLFLASDEARFITGVTLPVDGGSCLK
NT seq 837 nt   +upstreamnt  +downstreamnt
atggcaggacgcgtagaaggcaaggtcgctttcatcaccggtgcggcacgcggacaggga
cgtgcccacgcggtacggctcgccgaagagggcgccgacatcatcgccgtcgacatctgc
aagcagatcgacagcgtgctgatcccgttgtccacaccggaggatctcgccgagacggcc
gatctggtcaagaacgccggcggacgcatccacaccgccgaggtggacgtgcgtgactac
gacgcgctgaaggccgccgtcgacgccggcgtcgaggagttcggcaggctcgacatcatc
gtggccaacgccggcatcggcaacggcggacagacgctcgacaagacggacgagcccgac
tgggacgacatgatcggtgtcaacctgtccggcgtgtggaagaccgtcaaagccggtgtg
ccgcacatcctcgccggcggcaacggcggctcgatcatcctgaccagctcggtcggtggc
ctcaaggcctacccgcacaccggccactacgtcgccgccaagcacggcgtcgtcggcctg
atgcggactttcgcggtcgagctgggcgcgcagaacatccgcgtcaactcggtccacccg
accaacgtcaacactcccctgttcatgaacgagcccacgatgaagctgttccggccggac
ctggagaacccgggcccggacgacatgaaggtcgtcggccagctgatgcacacgctgccg
atcggctgggtggagcccgaggacatcgcgaacgccgtgctgttcctggcctccgacgag
gcacgcttcatcaccggcgtcaccctgcccgtcgacggcggcagctgcctgaagtga

DBGET integrated database retrieval system