KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_22350Help
Entry
Mspyr1_22350      CDS       T01376                                 

Definition
(GenBank) fructose-2,6-bisphosphatase
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00860  Porphyrin and chlorophyll metabolism
msp01100  Metabolic pathways
msp03030  DNA replication
Module
msp_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:msp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mspyr1_22350
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Mspyr1_22350
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:msp03032]
    Mspyr1_22350
Enzymes [BR:msp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Mspyr1_22350
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     Mspyr1_22350
DNA replication proteins [BR:msp03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     Mspyr1_22350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H
Motif
Other DBs
NCBI-ProteinID: ADT98884
UniProt: E6TFG8
Position
2306684..2307754
Genome map
AA seq 356 aa AA seqDB search
MKVIVECDGGSRGNPGPAGYGAVVWSADRESVLAEARSAIGTATNNVAEYRGLIAGLESA
AQTGATEVEVRMDSKLIVEQMAGRWRVKHPDLAALHRQAADLARRFEHITYSWIPREQNS
YADRLANEAMDAAAGEATPTEVVTNPAGWTGAKGAPTRLLLLRHGQTPLSVERRYSGRGN
PELTELGSRQAGAAAKYLGDRGGIDAVIASPLQRAYDTAAAAASTLGRDVVVDDDLIETD
FGAWEGLTFSEASQRDPELHRRWLKDTSVPPPGGESFDAVATRVHRAQRRIVEEHAGQTV
LIVSHVTPIKTLLRLALDAGPAMLYRLHLDLASLSIAEFYPDGAASVRLVNQTAYL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtcatcgtcgaatgcgacggtggttcgcgtggcaacccgggtcccgccgggtac
ggcgcggtggtgtggtccgccgatcgggaatcggtgctcgccgaagccaggtcggcgatc
ggcaccgcgaccaacaacgtcgccgaataccgtggtctgatcgccggtttggagtccgcc
gcgcagacgggcgccaccgaggtcgaggtgcggatggactccaaactcatcgtggaacag
atggccgggcgctggcgggtcaagcacccggacctcgccgccctgcaccggcaggcggcg
gacctggcacgccgattcgagcacatcacctactcgtggattccgcgtgagcagaacagt
tatgccgatcggctggccaacgaggcgatggacgcggcagccggagaagcgacacccacc
gaggtcgtcacgaatccggccgggtggaccggcgccaagggcgcgcccaccaggctgctg
ctcctgcgccacgggcagacgccgctgtcggtcgagcgccgctattccgggcgaggcaac
ccggagctgaccgaactcggcagccggcaggcgggcgccgccgcgaaatatctgggggac
cgcgggggaatcgacgccgtcatcgcctcaccgctgcagcgcgcgtacgacaccgcggcc
gccgcggcttcaacgctcgggcgcgacgtcgtggtcgacgacgacctgatcgagaccgat
ttcggcgcctgggaaggactgacgttcagtgaagcctcccagcgtgatcccgaactgcac
cggcgctggttgaaggacacctcggtgcccccaccgggcggggagagcttcgacgcggtc
gcgacgagggttcaccgcgcgcagcggcggatcgtcgaggagcatgccggccagacggtg
ctgatcgtgtcgcatgtgaccccgatcaagacgctgttgcgcctggccctcgacgccggt
cccgcgatgctgtaccggctgcacctcgacctggcgtcgttgtcgatcgcggagttctat
cccgacggtgcggcttcggtgcgtctggtcaaccagaccgcctacctatga

DBGET integrated database retrieval system