KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_22670Help
Entry
Mspyr1_22670      CDS       T01376                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00020  Citrate cycle (TCA cycle)
msp00310  Lysine degradation
msp01100  Metabolic pathways
msp01110  Biosynthesis of secondary metabolites
msp01120  Microbial metabolism in diverse environments
msp01130  Biosynthesis of antibiotics
msp01200  Carbon metabolism
Module
msp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
msp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mspyr1_22670
  Amino acid metabolism
   00310 Lysine degradation
    Mspyr1_22670
Enzymes [BR:msp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mspyr1_22670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Trypan_PARP Biotin_lipoyl_2 GCV_H DUF2254
Motif
Other DBs
NCBI-ProteinID: ADT98912
UniProt: E6TG59
Position
complement(2343661..2345523)
Genome map
AA seq 620 aa AA seqDB search
MAISVQMPALGESVTEGTVTRWLKQEGDTVEEDEPLLEVSTDKVDTEIPSPASGVLKKIV
AQEDDTVEVGGELAVIGDADDSDSDDSDSDDAGDSDDSEAEDSGDEAEPAAEESEPEPEP
EPEDEDEPEPEPKKKSSGGSGSSGSGTSVTMPELGESVTEGTVTRWLKEVGDTVEVDEPL
VEVSTDKVDTEIPSPVAGTLLSITAEEDDTVEVGGELAKIGDAGAEEESEPEPEPEPEPE
PEPEPEPEPEPEPKQTKPESKPSEEAAPEPKSESKPEAESKPEPKPKPEPEPKRESKPEA
ESSGDSPYVTPLVRKLAGEHGVDLASVKGTGVGGRIRKQDVLAAAEKSKAPKEDAPKAEP
AAEAPGKTTQAPAPEGALAHLRGTTQKANRIRQITAKKTRESLQTTAQLTQVHEVDMTRI
VALRAKAKAGFAEREGVNLTYLPFIARAVIDALKLHPNVNASYNEESKEITYHEAEHLGI
AVDTEQGLLSPVIHNAGDLSLGGLARAISDIAGRARSGNLKPDELSGGTFTITNIGSQGA
LFDTPILVPPQAAMLGTGAIVKRPRIIVDEFGNESIGVRSVSYLPLTYDHRLIDGADAGR
FVTTIKRRLEEGAFEADLGL
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atggcaatctccgtccagatgcccgcactcggagagagcgttaccgaggggaccgtcacc
cgctggttgaagcaggagggagacacggtcgaggaggacgagccactgctcgaggtgtcg
accgacaaggtcgacaccgagatcccgtctccggcatcaggtgtgttgaagaagatcgtc
gcgcaggaggacgacaccgtcgaggtcggcggagagctcgccgtgatcggcgacgccgac
gacagtgactccgacgacagtgactccgacgatgccggcgacagtgacgacagcgaggcc
gaggacagcggcgacgaggccgaacctgccgccgaggaatccgagcccgagcccgagccg
gaacccgaagacgaagacgagcccgaacccgagcccaagaagaagtcctcgggcggatcc
gggtcctccggatcggggacgtcggtgacgatgcccgagctcggcgagtcggtcaccgaa
ggcaccgtgacgcggtggctgaaggaggtcggcgacaccgtcgaggtcgacgagccgctc
gtcgaggtgtccaccgacaaggtcgacaccgagatcccgtcgcccgtcgccggcactctg
ctgtcgatcacggccgaggaggacgacaccgtcgaggtcggcggagagctcgccaagatc
ggtgacgcgggcgccgaggaagaatccgagccggaaccggaaccggaaccggagcccgaa
cccgagcccgaacccgagcctgaacccgagcccgagccgaagcagacgaagcccgagtcc
aagccctccgaggaggcggcacccgagcccaagtccgagtccaagcccgaagccgagtcc
aagcccgagcccaagccgaagcccgaaccggagcccaagcgcgagtcgaagcccgaagcc
gagtcgtcgggcgacagcccctacgtgacgccgctggtgcgcaagctggccggtgagcac
ggcgtcgacctcgcgtcggtcaagggcaccggtgtcgggggacgcatccgcaagcaggac
gtgctcgcggccgccgagaagagcaaggcgcccaaggaggacgccccgaaggcggaaccg
gccgccgaggctccgggcaagaccactcaggcaccggcgccggagggcgcgctggcccac
ctgcgcggcacgacgcagaaggccaaccggatccggcagatcacggccaagaagacccgg
gagtcgctgcagaccacggcacagctgacccaggtccacgaggtcgacatgaccaggatc
gtcgcgctgcgggccaaggccaaggcgggcttcgccgagcgcgagggtgtcaacctgacc
tacctgccgttcatcgccagagcggtcatcgacgcgttgaagctgcatccgaacgtcaac
gccagctacaacgaggaatccaaggagatcacctaccacgaggccgagcacctgggcatc
gccgtcgacaccgagcagggcctgctctccccggtgatccacaacgccggcgacctgtcg
ctgggcgggctggcgcgggccatctccgacatcgccgggcgtgcccgctcgggcaacctc
aagcccgacgagctgtccggcggcacgttcaccatcaccaacatcggcagccagggcgcg
ttgttcgacacaccgatcctggtcccgccgcaggcggcgatgctgggtaccggtgcgatc
gtcaagcgcccccgcatcatcgtcgacgagttcggtaacgagtcgatcggtgtgcgctcg
gtgagctacctgccgctgacctacgatcaccgcctcatcgacggtgccgacgcgggacgg
ttcgtgaccaccatcaagcggcgtctcgaagaaggtgcgttcgaggccgacctggggctg
tag

DBGET integrated database retrieval system