KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_29420Help
Entry
Mspyr1_29420      CDS       T01376                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00260  Glycine, serine and threonine metabolism
msp00400  Phenylalanine, tyrosine and tryptophan biosynthesis
msp01100  Metabolic pathways
msp01110  Biosynthesis of secondary metabolites
msp01130  Biosynthesis of antibiotics
msp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mspyr1_29420
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mspyr1_29420
Enzymes [BR:msp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mspyr1_29420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ADT99561
UniProt: E6TAI0
Position
complement(3057875..3058663)
Genome map
AA seq 262 aa AA seqDB search
MSRLAGLFDSCRAEGRSALIGYLPTGFPDVDTSIQAMVALVESGCDIVEVGVAYSDPGMD
GPVIAAATEVALRGGVRVHDAFRAVEAISNAGGKAVVMTYWNPVLRKGVDTFARDLASAG
GLGLITPDLIPDEADDWFAASEAHDLDRIFLVAPSSTPERLAETVQASRGFVYAASTMGV
TGARDAVSNAAPELVARVKAISDIPVGVGLGVRSREQAAEIGAYADGVIVGSALVSALKE
GIPAVRSLTAELADGVRQRITA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgagccggctggccgggctgttcgactcctgccgtgccgagggccgttcggcgctgatc
ggctatctgcccaccgggtttccggatgtcgacacgtcgatccaggcgatggtcgcgctg
gtcgagtctggctgcgacatcgtcgaggtgggtgtcgcgtactcggaccccggcatggac
ggcccggtcatcgcggcggcgaccgaagtggcgttgcggggcggcgtccgggtgcacgac
gcgttccgcgcggtcgaggcgatcagcaatgccggcggcaaggcggtcgtgatgacgtac
tggaatccggtgttgcgcaagggagtcgacacgttcgcccgtgacctggcgtcggcgggc
gggctcgggttgatcacgccggacctgatccccgacgaggccgacgattggttcgccgcc
tccgaagcacacgatctggatcggatcttcctggtggccccgtcgtcgacgccggagcgt
ctcgccgagacggtgcaggcgtcccgcggattcgtctacgcggcgtccacgatgggcgtc
accggcgcacgcgacgcggtgtccaacgctgcgccggagctcgtcgcgcgcgtgaaggcc
atctcggacatcccggtcggtgtggggctgggcgtgcggtcccgtgagcaggcagcggag
atcggcgcctacgccgacggcgtcatcgtcggatcggcactggtgtcggcgctcaaggag
ggcatccccgcggtgcgctcgctgacagcggaacttgcagacggcgtacggcagaggatc
actgcgtga

DBGET integrated database retrieval system