KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_36070Help
Entry
Mspyr1_36070      CDS       T01376                                 

Definition
(GenBank) uncharacterized conserved protein
  KO
K16149  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00500  Starch and sucrose metabolism
msp01100  Metabolic pathways
msp01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mspyr1_36070
Enzymes [BR:msp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mspyr1_36070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 DUF1957
Motif
Other DBs
NCBI-ProteinID: ADU00216
UniProt: E6TIE5
Position
3731381..3732976
Genome map
AA seq 531 aa AA seqDB search
MSHADVASGDEKNSVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWSAAYLPLIRVLRT
LAAENRRHLITLGITPVVAAQLDDPYCLQGMNHWLANWQLRALEASTTRSSEPGAPPASQ
PQALRQFGVREYEEAERELGEFDALWRHGASPLFRELLDNQTIELLGGPLAHPFQPLLNP
RLREFALREGLADAHTRFAHRPSGIWAPECAYAPGMEIGYDDAGVTHFMVDGPSLRGDTS
LGRPVGGSDVVAFGRDLQVSYRVWSPKSGYPGHSAYRDFHTYDHATGLKPARVTGRNVPS
DAKAPYDPARADAAVDVHVADFVDTVRRRLAAESERIGRPAHVVAAFDTELFGHWWYEGP
VWLERVLRALPAAGVRVGTLSDAIAEGYVGAPVDLPPSSWGSGKDWQVWSGDQVADLVQL
NSEVVDAALSTVDKALAHGAALGSPTPRDFVADQILRETLLTVSSDWPFMVSKDSAADYA
RYRAHLHAHATREISDALASGRREHAQQLADGWNRADGLFGALDARRLPAT
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgagccacgcagacgtcgcgtctggggacgaaaagaattcggtaccaggacttttcacg
ctggttctgcacacgcatctgccgtggctcgcgcatcacggtcgctggccggtcggcgag
gaatggctctatcagtcctggtcggctgcgtacctgccgctgatacgcgtgctgcgcacg
ctggccgccgagaaccgccgacacctgatcacgctgggcatcaccccggtggtggccgcc
cagttggacgatccgtattgcctgcagggcatgaaccactggctcgcgaactggcaactg
cgggcgctggaggcctcgacgacgcggagctcggagccgggcgccccacccgcatcccag
ccacaggccctgcggcagttcggtgttcgcgagtacgaggaggccgaacgggagctcggt
gagttcgacgcgctctggcgacacggcgcgagcccgttgtttcgcgagctgctcgacaac
cagaccatcgaactgctcggcggcccgctcgctcaccccttccagccactgctgaatcca
cgtctgcgcgagttcgcgctgcgcgagggtctcgccgatgcccacacgcggttcgcccac
cgcccgagcgggatctgggcgccggaatgcgcgtacgcaccggggatggaaatcggctac
gacgacgccggtgtcacccacttcatggtcgacgggccgtcgttgcgcggagacacctcg
ctcggcagaccggtcggcggttccgatgtcgtcgcgttcggtcgcgaccttcaggtgagc
taccgcgtgtggtcgcccaaatcgggatatcccggacacagcgcctaccgcgacttccac
acctacgaccacgccaccgggctcaaacccgctcgggtgaccggacgcaacgtgccctcg
gacgcgaaggcaccctacgatccggcgcgcgccgacgccgcggtggacgtccacgtcgcc
gacttcgtcgacaccgtgcgccggcgcctcgccgccgagagcgaacgcatcggccggccc
gcccatgtcgtcgccgcgttcgacaccgagctgttcgggcactggtggtacgagggcccg
gtctggctggagcgggtgttgcgggcgctgcccgccgccggcgtgcgggtcggcacgctg
tcggatgcgatcgccgagggctacgtcggcgcccctgtcgatctcccaccgagctcgtgg
ggctcgggcaaggactggcaggtgtggtcgggcgaccaggtggccgatctggtgcagctc
aacagcgaggtcgtcgacgcggcgctgagcaccgtggacaaggcactcgcccacggcgcg
gcgttgggttcgcccaccccaagggatttcgtggccgaccagatccttcgcgagaccttg
ttgacggtctcgagtgactggccgttcatggtgagcaaggactccgccgcggactatgcg
cgctaccgcgcccatctgcacgcccacgccacgcgggagatctccgacgcactggcgtcg
ggccgccgcgagcacgcgcagcagctggccgacggctggaatcgcgccgacgggctcttc
ggtgcgctcgacgcccggaggctgccggcgacatga

DBGET integrated database retrieval system