KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_47030Help
Entry
Mspyr1_47030      CDS       T01376                                 

Definition
(GenBank) predicted hydrolase or acyltransferase of alpha/beta superfamily
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00984  Steroid degradation
msp01100  Metabolic pathways
msp01120  Microbial metabolism in diverse environments
msp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:msp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Mspyr1_47030
Enzymes [BR:msp01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     Mspyr1_47030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 DUF1100 Ndr DUF915 UPF0227 Peptidase_C42
Motif
Other DBs
NCBI-ProteinID: ADU01247
UniProt: E6THI4
Position
complement(4887079..4887963)
Genome map
AA seq 294 aa AA seqDB search
MTSFAAEAAQQQEITFESTSRYAQVREDMRLHYHEAGVGNPKTVVLLHGGGPGASSWSNF
GRNIPVLAKHFHVLAVDQPGYGHSDKHTEHEQYNRYSATALLNLFDHLGIEKAALVGNSL
GGGTAVRFALDNGKRAGKLVLMGPGGLSVNLFSPDPTEGVKLLGRFAAEPTRENIEKFLR
IMVFDQAMITPELVEERFQIASTPESLAATKAMGKSFAGADFELGMMWRDVYKLRQRVLL
IWGREDRVNPLDGALVALKQIPRVQLHVFGQCGHWAQLEKFDEFNKLTIDFLTN
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtccttcgccgcggaagctgctcagcagcaggagatcacgttcgagtcgacgtcc
cgctacgcccaggtccgcgaggacatgcggttgcactatcacgaagcgggagtgggtaat
cccaagacggtggtgttgctgcacgggggcggcccgggcgcgtcgagctggtcgaacttc
ggacgcaacatcccggtgctggccaagcactttcatgtgctggccgtggatcagccgggc
tacgggcactccgacaagcacaccgagcacgagcagtacaaccgctacagcgccactgcg
ctgctgaacctgttcgaccacctgggcatcgaaaaggctgcgctggtgggcaattctctc
ggtggcggtacggcggtgcggttcgcgctggacaacggcaagcgcgcgggaaagctcgtg
ctgatggggccgggcggactgagcgtcaacctattctcgccggatccgaccgagggtgtc
aagctgctcggcaggttcgccgccgagcccacccgtgagaacatcgagaagttcctgcgc
atcatggttttcgaccaggccatgatcaccccggagctggtcgaggagcggttccagatc
gccagcacccccgagtcgttggccgccaccaaggcgatgggtaagtcgttcgccggcgcg
gacttcgagctcgggatgatgtggcgcgacgtgtacaagctgcgtcaacgggtactgctc
atctggggccgcgaggaccgggtgaacccgctcgacggagccctggtggcgctcaagcag
atcccccgggtgcagctgcatgttttcgggcagtgcgggcactgggcgcagctggagaag
ttcgacgagttcaacaagctcaccatcgatttcctcacgaactag

DBGET integrated database retrieval system