KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_47210Help
Entry
Mspyr1_47210      CDS       T01376                                 

Definition
(GenBank) cysteinyl-tRNA synthetase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:msp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Mspyr1_47210
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:msp01007]
    Mspyr1_47210
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:msp03016]
    Mspyr1_47210
Enzymes [BR:msp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     Mspyr1_47210
Amino acid related enzymes [BR:msp01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   Mspyr1_47210
Transfer RNA biogenesis [BR:msp03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Mspyr1_47210
 Prokaryotic Type
    Mspyr1_47210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f DALR_2
Motif
Other DBs
NCBI-ProteinID: ADU01265
UniProt: E6THK2
Position
complement(4905786..4907213)
Genome map
AA seq 475 aa AA seqDB search
MTDRPAAGMRLYDTLSGGVRDFAPLRPGHVSIYLCGATVQGLPHIGHVRSGVAFDVLRRW
LTAKGFDVAFIRNVTDIDDKILIKAADAGRPWWEWAATYERAFTAAYDALGVLPPSAEPR
ATGHITQMVELIDRLIERGHAYCADQEGNGDVYFSVSTLPDYGKLSGHRIDDVHQGEGVA
TGKRDQRDFTLWKGAKPGEPSWPTPWGRGRPGWHTECVAMCEAYLGAEFDIHAGGMDLVF
PHHENEIAQAEAAGDGFARFWLHNGWVTMGGEKMSKSLGNVLAIPAVLQRVRAAELRYYL
GSAHYRSMLEFSENALQDAARAYSGVEDFLHRVRVRVGAVVPGEWTPKFGAALDDDLAVP
AALAEVHAARAEGNRALDAGDHDAALTHAMSIRAMMGILGADPLDERWESRDETSAALAA
VDVLVHAEVRRREDARARRDWAEADAIRDRLKEAGIEVTDTGDGPQWSLLDGTDK
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgatcgccccgcagctggcatgcggctctatgacacgttgtctggtggcgtgcgc
gatttcgcgccgctgcggcccggccatgtctccatctacctctgcggggccaccgtgcag
ggtctgccccatatcgggcacgtccgcagcggtgtcgcgttcgacgtgttgcgccggtgg
ttgaccgccaaggggttcgacgtcgcgttcatccgcaacgtgaccgacatcgacgacaag
atcctgatcaaggccgctgacgccggcaggccgtggtgggagtgggcggcgacctatgag
cgcgcgttcaccgccgcctacgacgctctgggcgtgctaccgccgtccgccgaaccccgc
gccaccggccacatcacccagatggtcgagctgatcgaccggctcatcgagcgcgggcac
gcctactgtgccgatcaggaaggcaacggggacgtctacttcagcgtctccacgctgccc
gactacggcaagctctcggggcatcggatcgacgacgtccaccagggtgagggtgtcgcg
accggcaagcgcgatcagcgcgacttcacgttgtggaagggcgccaagcccggtgagccg
tcctggccgacgccgtggggtcggggccggcccggatggcacaccgagtgcgtcgcgatg
tgcgaggcgtatctgggggcggagttcgacatccacgccggcggaatggatctggtgttc
ccgcaccacgagaacgagatcgcgcaggccgaagccgccggcgacggcttcgcccggttc
tggctgcacaacggctgggtcaccatgggcggcgagaagatgagcaagtcgctgggcaac
gtgctggcgattcccgctgtgctgcaacgggttcgggccgccgagctgcggtactacctg
ggcagcgcgcattaccgctcgatgctggagttctccgagaacgcgctgcaggacgcggcg
agggcctacagcggcgtcgaggacttcctgcaccgcgtacgggtgcgggtcggtgcggtg
gttccgggggagtggacgccgaagttcggcgcggcgctcgacgacgacctagcggtgccg
gctgcgctggccgaggtgcacgccgcgcgggcggagggcaaccgggcactcgacgccggc
gaccacgacgccgcgctgacccacgccatgtcgatccgcgcgatgatgggcatcctgggc
gccgacccgctcgacgagcggtgggagtcgcgagacgagacgtcggcggcgctcgccgcg
gtcgacgtcctggttcatgcggaggtccgtcggcgcgaagacgccagggcccggcgcgac
tgggccgaggccgacgccattcgcgaccgcctgaaagaggcgggtatcgaggtgaccgac
accggcgacggtccccagtggtcactcctggacgggacggacaagtag

DBGET integrated database retrieval system