KEGG   Mycolicibacterium gilvum Spyr1: Mspyr1_49910Help
Entry
Mspyr1_49910      CDS       T01376                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
msp  Mycolicibacterium gilvum Spyr1
Pathway
msp00071  Fatty acid degradation
msp00280  Valine, leucine and isoleucine degradation
msp00281  Geraniol degradation
msp00310  Lysine degradation
msp00360  Phenylalanine metabolism
msp00362  Benzoate degradation
msp00380  Tryptophan metabolism
msp00410  beta-Alanine metabolism
msp00627  Aminobenzoate degradation
msp00640  Propanoate metabolism
msp00650  Butanoate metabolism
msp00903  Limonene and pinene degradation
msp00930  Caprolactam degradation
msp01100  Metabolic pathways
msp01110  Biosynthesis of secondary metabolites
msp01120  Microbial metabolism in diverse environments
msp01130  Biosynthesis of antibiotics
msp01212  Fatty acid metabolism
Module
msp_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:msp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mspyr1_49910
   00650 Butanoate metabolism
    Mspyr1_49910
  Lipid metabolism
   00071 Fatty acid degradation
    Mspyr1_49910
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mspyr1_49910
   00310 Lysine degradation
    Mspyr1_49910
   00360 Phenylalanine metabolism
    Mspyr1_49910
   00380 Tryptophan metabolism
    Mspyr1_49910
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mspyr1_49910
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mspyr1_49910
   00281 Geraniol degradation
    Mspyr1_49910
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mspyr1_49910
   00627 Aminobenzoate degradation
    Mspyr1_49910
   00930 Caprolactam degradation
    Mspyr1_49910
Enzymes [BR:msp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mspyr1_49910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADU01522
UniProt: E6TLI6
Position
5168394..5169215
Genome map
AA seq 273 aa AA seqDB search
MGNYEAVTVEIADHIAQVTLIGPGKGNAMGPAFWSELPVVFRELDADPDVRAIVLVGSGR
NFSYGLDLAAMGDTLGSMMSDASSSKPRADFHTRLKSMQDAITAVADCRTPTIASVHGWC
IGGGVDLISAVDIRYASSDAKFSVREVKLAIVADVGSLARLPLILSDGHLRELALTGKDI
DAARAEKIGLVNDVHPDADASLAAARATAAEIAANPPHTVHGIKDVLDEQRTAQVSASLR
YVAAWNSAFLPSKDLTEGITAMFEKRAPNFTGE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactacgaagccgtcacggtcgagatcgccgatcacatcgcgcaggtgacgctg
atcggccccggtaagggcaacgccatgggcccggcgttctggtccgagcttcccgtcgtg
ttccgcgaactcgacgcagatcccgacgtccgcgcgatcgtgctggtcggctccggacgc
aacttcagctacggcctcgacctggccgcgatgggcgacaccctcggctcgatgatgagc
gacgcgtcgtcgtcgaagccgcgcgccgacttccacacgcgcctgaagagcatgcaggac
gcgatcaccgccgtcgccgactgccgcaccccgaccatcgcgtcagtgcacggatggtgc
atcggtggtggcgtcgacctgatctcggcggtcgacatccgctacgccagcagcgacgcc
aagttctcggtgcgcgaggtcaagctcgcgatcgtcgccgacgtcggctcgctggcccgg
ctgccgctgatcctgtccgacgggcacctgcgcgaactggccctgaccggcaaggacatc
gacgcggcgcgggccgagaagatcggcctggtcaacgacgtccaccccgacgccgacgcc
tcgctggccgccgcgcgcgcgaccgccgccgagatcgccgccaacccgccgcacaccgtc
cacggcatcaaggacgtcctcgacgagcagcgcaccgcccaggtctcggccagcctgcgc
tacgtcgcggcatggaactcggcgttccttccgtcgaaggacctcaccgagggcatcacg
gcgatgttcgagaagcgcgcgccgaacttcaccggcgagtag

DBGET integrated database retrieval system