KEGG   Marinobacter salinus: BKP64_07750Help
Entry
BKP64_07750       CDS       T04766                                 

Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
msq  Marinobacter salinus
Pathway
msq00620  Pyruvate metabolism
msq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BKP64_07750
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:msq02000]
    BKP64_07750
Enzymes [BR:msq01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     BKP64_07750
Transporters [BR:msq02000]
 Other transporters
  Primary active transporters [TC:3]
   BKP64_07750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 ADH_zinc_N RnfC_N YqfD
Motif
Other DBs
NCBI-ProteinID: AOY88073
UniProt: A0A1D9GKA9
Position
complement(1691805..1693592)
Genome map
AA seq 595 aa AA seqDB search
MTDTKKPLGITDVILRDAHQSLLATRMRLDDMLPIAEKLDKVGFWSLESWGGATFDSCIR
YLGEDPWERIRELKKAMPNTPQQMLLRGQNLLGYRHYADDVVERFVDRAAENGVDVFRIF
DAMNDPRNLDTAIKAVRKTGKHAQGTISYTTSPVHTIEMWVELAKEVADMGADSIAIKDM
AGILKPYVAFDLVSRLKKELDIPIHMQCHATTGMSTATAIKAAEAGIDNVDTAISSMSMT
YGHSPTEAVVAILEGTDRDTGLDLNLLEEIASYFREVRKKYAKFEGSLRGTDSRILIAQV
PGGMLTNMENQLREQNASDKFDEVLAEIPKVREDLGYIPLVTPTSQIVGTQAVLNVLTGE
RYKSISKETSAILKGEYGSAPAPFNKELQERVLDGKEAITCRPADLIDSEMDKLTDELKT
LAKEKGIKLAENTVDDVLTYALFPQIGLKFLENRDNPDAFEPIPSAADVAPAKKAGGPET
YTVEVNGNKFVVAVSEGGEITQIQGEGGAASAPAASSAPAPAAGDGEPVVAPLGGNIFKI
LVSPGDVVEEGDVLIILEAMKMETEVRAPKAGTIGEVFIKVGDAVSPDDEMLTIA
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacgaagaaaccgctggggattacggacgttatcctgcgtgacgcccaccag
tccctgcttgccacccgtatgcggcttgatgacatgctacccattgccgagaaactcgac
aaagtcggtttctggtccctggaatcctggggtggagccaccttcgactcctgtatccgt
tacctgggcgaagatccctgggagcgtatccgcgaactgaaaaaggctatgcccaacact
ccgcagcaaatgctgctgcgtggccagaatctgttgggctaccgccattacgcggatgat
gtggtcgagcggtttgtagatcgtgccgccgaaaatggcgttgacgtgttccgtattttt
gacgcgatgaacgatccccgcaacctggacaccgccatcaaggccgttcgcaagaccggc
aagcatgcgcagggcactatctcttataccaccagcccggtgcacaccattgagatgtgg
gttgagctggcgaaggaagtcgcagacatgggggcggattccattgccatcaaggacatg
gcgggtattctcaaaccgtacgtggcctttgatctggttagccgcctgaagaaagaactg
gatatcccgattcacatgcagtgccatgcgaccacgggcatgtctaccgccacagccatc
aaggcagcggaagccggtatcgataacgtggatacggccatttcctccatgagcatgacg
tatggccactcgcccaccgaggcggttgttgccattcttgaaggtactgaccgtgacacc
ggccttgacctgaacctgcttgaagaaattgccagttacttccgcgaagtccgcaagaag
tacgcaaaatttgaaggcagcctccggggtaccgattcccgtatcctgattgctcaggtg
cctggtggcatgctgaccaacatggaaaaccagctgagagaacagaacgcgagcgataag
tttgatgaggttctggctgagattcccaaggttcgcgaagacctgggttacatcccgctg
gtgactccgacttcccagatcgttggtacccaggcggtgctgaacgttctgaccggtgag
cgttacaagtctatctccaaggaaacctccgcaatcctgaaaggcgaatacggctccgcg
ccagcgccgttcaacaaggagttgcaggagcgtgttctggatggcaaagaagcgatcact
tgccgtcccgccgacctcattgactcggaaatggacaaactgaccgacgagctgaagacg
ctggccaaagagaaaggcatcaaactggcggaaaacaccgttgatgacgtgctgacttac
gctctgttcccgcagattggcctgaaattcctcgaaaatcgcgataatccggatgccttt
gagccgattccgagcgctgctgatgtggcacctgcgaagaaggccggcggccccgagact
tacaccgttgaagtcaatggcaataagtttgtggtggcggtgtccgaaggtggcgaaatc
acccaaatccagggcgagggcggtgctgcttctgcgcctgccgcgtcttcggctcctgcg
cctgcagcgggtgatggtgagccagttgttgcccctctgggcggcaatatcttcaagatt
ctggtatcgccgggtgacgttgttgaagagggcgatgtgctgattatcctcgaagccatg
aagatggaaaccgaggttcgcgcacctaaggccggtactatcggtgaagttttcatcaag
gtcggtgatgccgtctcccctgatgatgaaatgctgacaatcgcataa

DBGET integrated database retrieval system