KEGG   Marinobacter salinus: BKP64_11880Help
Entry
BKP64_11880       CDS       T04766                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
msq  Marinobacter salinus
Pathway
msq00740  Riboflavin metabolism
msq00790  Folate biosynthesis
msq01100  Metabolic pathways
msq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:msq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BKP64_11880
   00790 Folate biosynthesis
    BKP64_11880
Enzymes [BR:msq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     BKP64_11880
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     BKP64_11880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AOY88810
UniProt: A0A1D9GN28
Position
complement(2555764..2556879)
Genome map
AA seq 371 aa AA seqDB search
MALNSIEDIIEDIRLGKMVILMDDEDRENEGDLVMAAEHCSPAAINFMARFGRGLICMPM
TRDRCEQLGLPLMVQQNASGFGTKFTLSIEAKEGVTTGISAADRARTVQAAVARDAKASD
LVQPGHIFPLMADPGGVLSRAGHTEASCDLAALAGSEPAGVICEIMNDDGSMARREDLER
FAEEHGLKIGTIADLIHYRTMNERTIECVEENKLDTEYGEFSLRTYRDNIQGATHLAMVM
GDISADEPVYVRVHITDTLRDLLGARRKDSRSWPLHHALEKVATEGKGAVVLLNSAEDSY
NLEDRIHEFFDEGQGSAGKGSSGVYFTVGTGSQILRDIGVGKMRLLSPPIKFSAISGFDL
EVVEYVPYTPE
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcactgaacagcattgaagacattattgaagatatccgtctgggcaagatggttatt
ctgatggacgacgaagatcgtgaaaatgaaggcgatctggtcatggcagctgaacattgc
tcccctgcagccattaatttcatggcgcgctttggtcgtggattgatttgtatgccaatg
acccgtgatcgttgcgaacagctgggcctaccgctgatggtccagcagaacgcatccggt
tttggtaccaagttcacgctgtccatcgaagcgaaagaaggcgtgaccaccggcatttcc
gcggcagatcgcgcccgaacggttcaggctgcagttgcgcgcgatgccaaggcgtcggat
cttgtccagcccggccatatcttcccgctgatggcggatccgggcggtgtgcttagccgt
gccggccatactgaagcctcctgcgatctcgccgcacttgccggctctgaacccgctggc
gtgatatgtgaaatcatgaacgatgacgggtccatggcacgccgtgaagaccttgaacgg
tttgcggaggagcatggtctcaagatcggtaccattgccgatttgatccactaccggacc
atgaatgagcgcacgattgagtgtgtggaagaaaacaagctggataccgagtatggagag
ttcagtcttcgcacttaccgggacaatatccagggtgcaacacacctggctatggtcatg
ggtgacatcagcgccgacgagccggtttatgtgcgtgtccatatcacggatacattaaga
gacctgctcggtgcccgccgcaaggattctcgtagctggccgttgcaccatgccctggaa
aaagtggccactgaaggtaagggtgccgtcgtgttgctcaacagcgccgaagacagctac
aaccttgaagaccggattcatgagttcttcgatgaaggccagggctctgccggcaagggc
agctctggtgtttactttaccgtgggcaccggctcgcaaatcttgcgggatattggcgtc
ggcaagatgcgcctgttgagcccgcctatcaagttctctgccatctccggattcgatctg
gaagtcgttgagtacgtcccttatacccccgaatga

DBGET integrated database retrieval system