KEGG   Marinobacter salinus: BKP64_12420Help
Entry
BKP64_12420       CDS       T04766                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
msq  Marinobacter salinus
Pathway
msq03010  Ribosome
Brite
KEGG Orthology (KO) [BR:msq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BKP64_12420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:msq03011]
    BKP64_12420
Ribosome [BR:msq03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BKP64_12420
  Bacteria
    BKP64_12420
  Archaea
    BKP64_12420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF1442
Motif
Other DBs
NCBI-ProteinID: AOY88912
UniProt: A0A1D9GMQ2
Position
complement(2675342..2675674)
Genome map
AA seq 110 aa AA seqDB search
MEVAAKYKGANLSAQKARLVADQVRGKAVEDALNILTFSPKKAAVVLKKALESAIANAEH
NEGLDVDELRVSTVMVDEGPTLKRIKARAKGRADRIFKRTCHITVKVADK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagcagccaagtacaagggcgctaacctctcagctcagaaagcacgtcttgtc
gctgaccaagtacgcggcaaggcggttgaggacgccctgaacattctgactttcagcccg
aagaaggcggcggtcgtgctcaagaaagctcttgagtctgccattgccaacgctgagcat
aacgaaggtctggacgttgacgaattgcgggtctccaccgttatggtggatgagggcccg
acgctcaagcggatcaaagctcgagccaaggggcgcgctgatcggattttcaagcgcacc
tgccatatcaccgtcaaggtcgccgacaagtag

DBGET integrated database retrieval system