KEGG   Marinobacter salinus: BKP64_15215Help
Entry
BKP64_15215       CDS       T04766                                 

Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
msq  Marinobacter salinus
Pathway
msq03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:msq00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    BKP64_15215
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:msq03400]
    BKP64_15215
Enzymes [BR:msq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BKP64_15215
DNA repair and recombination proteins [BR:msq03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BKP64_15215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Helicase_RecD Viral_helicase1 SH3_13 AAA_22 DUF2075 UvrD_C AAA_28 NTPase_1 AAA_16 UvrD-helicase T2SSE TrwB_AAD_bind
Motif
Other DBs
NCBI-ProteinID: AOY89407
UniProt: A0A1D9GP50
Position
3271863..3274112
Genome map
AA seq 749 aa AA seqDB search
MSKTRQSDQQISLDLSNEPDDKPAPSAPTRAHDTDALLASPDKMDALLDQWQQMEWIRPL
DVGFARLIRTLSAEQGEALHPLVLLLSALVSHQVGRGHVCIDLANLFADAGSILSLPPED
SVEAAGGLRTGETVCPEPDSILARVSLEDSLALLDKAQAVSDGSLTTPLVLNETRLYLRR
FWRYEQRIAEGIQARLAMSSPLQDAHSDMATTLGLALTALFGPPVDIDFQRLACALAARS
RFSVITGGPGTGKTTTVVKLLAALQAIAGKSGQRGGRKHRIRLAAPTGKAAARLNESIGG
AVSRLPLSQLPGNVTPDDIPTRVTTLHRLLGSRPDTRRFRHNRDNLLLVDILVIDEASMI
DMDLMASVFDALPATAQLILLGDKDQLASVDAGAVLGELCQRAADAHYTPETSCWLEAIT
GHSIPDNLSDASGQPLDQAVAMLRKSHRFSEDSGIRTLAEAVNTDTLDAGILRACRDGEF
DDVIWLNGRNPTPEPSNALAMICSHAVSGTPEAFREQGRGRIANHQPLPPPVGYHQYLSL
LNNHELDERSPRVDWDSLALQVLEAFSDFQILCALRKGPWGVEGINDLVARHLLAEKHIT
RAEGWYPGRPVLVTGNDYNLGLMNGDVGITFSVPWDRNQQGEPKDTLRVAFPATDGSDGI
RWISPSRLQQLETVYAMTVHKSQGSEFNHTCLVLPDRLSPIMTRELIYTGITRARNWFSL
ITGDASVLRDSVHQQVRRASGLAQRLSQP
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaacccgacagtctgaccagcagatctccctggatttgagcaatgaacccgat
gacaaaccggccccgtcagctccaactcgggcccacgatacagacgcgcttctggcaagt
ccggacaagatggatgcgctgctggatcagtggcagcagatggaatggatccgtccgctg
gatgtgggctttgcccgacttatccgaaccctgtcagcagagcagggtgaggcgctccat
ccgttggtattgctgctctcggccctggtctcgcatcaggtcggccggggccacgtgtgt
atcgatcttgccaacctgtttgccgatgccggcagcattctgtccctgccaccggaggat
tcggttgaggccgcaggcgggctcagaaccggcgagacagtctgtcccgaaccggacagc
atcctggcgcgggtcagcctggaggactccttagccctattagataaagctcaggcggta
agtgatggctcactgacgacaccgctggtactgaatgaaaccaggctgtacctgcgtcga
ttctggcgttacgaacaacgcattgccgagggcattcaggcgcgattggcgatgtcttct
ccattgcaagacgctcattccgatatggctaccaccctcggcctggctctaaccgcgctc
tttggcccccctgtcgatatcgatttccagagactcgcctgtgccctggcagcccgcagc
cggttttccgtgatcaccggagggccgggcaccggcaagacaaccaccgtcgtcaaactg
ctcgccgcgctccaggcgattgccggaaaatccggacaacgtggcggccgtaagcaccgg
atccgtctggcggcgccaaccggcaaagccgcagcccgcctgaatgaatccattgggggt
gccgtcagccgactgccgctcagccagttgcccggcaacgtaaccccggacgatatcccc
acccgggtaaccaccctgcaccgactgctcggcagccggcccgatacccgccgtttccgt
cataaccgggataacctgctgctggtggatatcctggtgatcgatgaagcatccatgatc
gacatggacctgatggcctcggtgtttgatgcgctgccggccaccgcccagctgatcctt
ctgggggacaaggatcagcttgcttcagtggatgccggcgccgtattgggcgagctgtgt
cagcgcgcggccgacgctcattacacccccgagacgtcgtgctggcttgaggcgattaca
ggccattcgataccggacaaccttagcgatgccagcggacagcccctcgaccaggccgtg
gccatgctccgtaaaagtcaccgtttcagtgaggacagcggtattcgtaccctggcggag
gccgtcaataccgatacgctggacgccggaatcctccgggcctgcagggacggtgaattt
gacgatgttatctggctgaatggccggaatccgacgccggaaccgagcaacgcactggcc
atgatctgttcccacgcggtttccggcacaccagaggccttccgtgaacagggccggggc
cgcatcgccaaccaccagccgctgccgccaccggtgggctaccatcagtaccttagcctg
ttgaacaaccacgaactggatgaaaggagtccaagagtagactgggacagcctggccctg
caggtgctggaagcattttcggacttccagattctgtgtgcccttcgcaaagggccgtgg
ggcgtggaaggcatcaacgatctggtggcacgacacctgttggcggaaaaacacattact
cgcgcggaaggctggtatccggggcgcccggtgctggtgaccggtaacgactacaatctg
ggactgatgaacggggatgtgggcattacctttagtgtgccctgggatcgaaaccagcag
ggtgagcccaaagacacgttgcgggtcgcatttccggccacagacggcagcgatggcatt
cggtggatttcgccaagccggctgcagcaactggaaactgtgtacgccatgaccgttcac
aaatcccagggctcggaattcaatcacacttgcctggtgttaccggaccggctcagcccg
ataatgacccgggaactgatctacacaggcatcacccgggcgaggaactggttcagcctg
attaccggtgacgccagcgtgctgcgggacagtgtccatcagcaggtaaggcgtgcttcc
ggtctggcgcagcggctcagtcaaccgtaa

DBGET integrated database retrieval system