KEGG   Marinobacter salinus: BKP64_18760Help
Entry
BKP64_18760       CDS       T04766                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msq  Marinobacter salinus
Pathway
msq00071  Fatty acid degradation
msq00072  Synthesis and degradation of ketone bodies
msq00280  Valine, leucine and isoleucine degradation
msq00310  Lysine degradation
msq00362  Benzoate degradation
msq00380  Tryptophan metabolism
msq00620  Pyruvate metabolism
msq00630  Glyoxylate and dicarboxylate metabolism
msq00640  Propanoate metabolism
msq00650  Butanoate metabolism
msq00900  Terpenoid backbone biosynthesis
msq01100  Metabolic pathways
msq01110  Biosynthesis of secondary metabolites
msq01120  Microbial metabolism in diverse environments
msq01130  Biosynthesis of antibiotics
msq01200  Carbon metabolism
msq01212  Fatty acid metabolism
msq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BKP64_18760
   00630 Glyoxylate and dicarboxylate metabolism
    BKP64_18760
   00640 Propanoate metabolism
    BKP64_18760
   00650 Butanoate metabolism
    BKP64_18760
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BKP64_18760
   00072 Synthesis and degradation of ketone bodies
    BKP64_18760
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BKP64_18760
   00310 Lysine degradation
    BKP64_18760
   00380 Tryptophan metabolism
    BKP64_18760
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BKP64_18760
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BKP64_18760
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BKP64_18760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msq04147]
    BKP64_18760
Enzymes [BR:msq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BKP64_18760
Exosome [BR:msq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BKP64_18760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOY90035
UniProt: A0A1D9GR67
Position
complement(4072624..4073802)
Genome map
AA seq 392 aa AA seqDB search
MRDVVIVAAKRTAIGTFGGGLSSLSADQLGTAVIKAILEETGVAGNQVNEVVLGQVLTAG
CGQNPARQSSINAGLPASVPAMTINKVCGSGLKAVHMAVQAIRCGDAELMIAGGQESMSQ
APHVLPNSRNGQRMGNWTMIDTMITDGLWDAFNDYHMGVTAENIVEKYGISREEQDNFAA
ASQQKAVAAQKAGYFDSQIVPVSIPQRKGDAVVVDTDEGPRDGVTGEGLGKLRPAFKKDG
TVTAGNASSLNDGAAAVMVCSAEKAKELGLTPLATLKAHANAGVDPTIMGTGPIPASQRC
LKLAGWSVDDLDLIEANEAFAAQSISVNRDLGWDTSKVNVNGGAIALGHPIGASGCRILV
SLLHEMVRRDAHKGLATLCIGGGMGVALAVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatgtcgtcattgttgctgccaagcggactgccatcggaacttttggcggcggc
ctgtccagcctgagtgcagaccagctcggcaccgccgttataaaggccatcctggaagaa
accggcgttgccggcaatcaggtaaatgaagttgtactcggccaggtcctgacggccggc
tgtggccagaacccggcccgccaatcctctatcaatgccggcctcccggcctccgtaccc
gccatgaccatcaacaaggtttgcgggtcaggcctcaaagccgttcatatggcggtgcag
gccatccgctgcggcgacgcggaactgatgattgccggtggtcaggagagcatgagccag
gcccctcacgtactgcccaacagccgcaacggccagcgcatgggcaactggaccatgatc
gacacgatgatcacggatggtctttgggatgccttcaacgactaccacatgggtgtgact
gccgagaacatagtcgagaaatacggcatcagccgggaagagcaggataacttcgccgca
gcgtcccagcaaaaggccgttgccgcccagaaagcgggttatttcgacagccagatcgtg
cctgtatctatcccccagcgtaaaggcgacgcggttgtcgtagacaccgacgaaggtccg
cgagatggcgtgaccggagaagggctgggcaagctgcggccggcattcaagaaagatggt
acggtcacggccggcaacgcgtcgtcgctgaacgacggtgcggctgctgtcatggtgtgc
agtgccgagaaagccaaagagcttggcctgactcctcttgccacgctcaaggcgcacgcc
aatgccggcgtcgaccccaccatcatgggcacaggtccgattcccgccagtcagcgttgc
cttaaactggccggctggagcgtggatgacctcgacctgatcgaagccaacgaagcattt
gccgcccagtccatctccgtaaaccgggatcttggctgggataccagcaaggtcaatgtt
aacggcggcgcgatcgccctgggccaccctatcggtgcgtccggctgccgtattctggtt
tccctgctgcacgagatggttcgccgtgacgcacacaagggcctggctaccctgtgtatc
ggcggcggcatgggtgttgccctcgctgttgagcgctga

DBGET integrated database retrieval system