KEGG   Marinobacter salarius: AU15_01005Help
Entry
AU15_01005        CDS       T03593                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
msr  Marinobacter salarius
Pathway
msr00071  Fatty acid degradation
msr00072  Synthesis and degradation of ketone bodies
msr00280  Valine, leucine and isoleucine degradation
msr00310  Lysine degradation
msr00362  Benzoate degradation
msr00380  Tryptophan metabolism
msr00620  Pyruvate metabolism
msr00630  Glyoxylate and dicarboxylate metabolism
msr00640  Propanoate metabolism
msr00650  Butanoate metabolism
msr00900  Terpenoid backbone biosynthesis
msr01100  Metabolic pathways
msr01110  Biosynthesis of secondary metabolites
msr01120  Microbial metabolism in diverse environments
msr01130  Biosynthesis of antibiotics
msr01200  Carbon metabolism
msr01212  Fatty acid metabolism
msr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:msr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AU15_01005
   00630 Glyoxylate and dicarboxylate metabolism
    AU15_01005
   00640 Propanoate metabolism
    AU15_01005
   00650 Butanoate metabolism
    AU15_01005
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AU15_01005
   00072 Synthesis and degradation of ketone bodies
    AU15_01005
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AU15_01005
   00310 Lysine degradation
    AU15_01005
   00380 Tryptophan metabolism
    AU15_01005
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AU15_01005
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AU15_01005
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AU15_01005
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:msr04147]
    AU15_01005
Enzymes [BR:msr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AU15_01005
Exosome [BR:msr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AU15_01005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHI30469
UniProt: W5YNJ7
Position
204186..205370
Genome map
AA seq 394 aa AA seqDB search
MSTDNVVIVSGVRTPMGGFQGSLAAVSAPELGAISIAEAIRRAGLQPADVQEVIMGNVLP
AGLKQGPARQAMRQAGLPDSTGATTINKLCGSGMKAAMFAHDVIKAGTNDIMVAGGMESM
SNAPYILQGVRSGYRMGPGQAPQDHMFLDGLEDAETGRLMGAFAQEMADKKGYTREEMDE
YAITSLTRAKRAIEEGLLKDEIIPVTVKTRKGEVVVEDDEQPHNANIEKIPSLRPAFAKD
GTVTAANASSISDGASALVLMRESEAEKRGLKPLARIVAHSTQSQHPSEFTCAPVGAIET
LFAKTGWTKDDVDLFEINEAFAMVAMMPIRELGLEPEKVNIHGGACAQGHPVGSTGSRLL
VTLMHSLKHYGKKKGVAALCIGGGEATAMAIELL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagcacagacaacgtcgtcatcgtcagcggtgtgcgcacccccatgggcggattccag
ggcagtctagccgcggtttccgcgccggagctgggcgctatcagtattgccgaagctatc
cgccgtgccggcttgcagccggcagacgtgcaggaagtgatcatgggcaatgtcctgccg
gcagggctcaagcaagggccggctcgccaggcaatgcgccaggcagggctaccggacagc
actggtgccactacgatcaataagctttgcggttcgggcatgaaagccgccatgtttgcc
cacgatgtgatcaaggccggcaccaacgatattatggttgccggtggtatggagagcatg
tccaatgcaccgtacattcttcagggtgttcgcagtggttaccgcatggggcctggccag
gcgcctcaggaccatatgttcctggacggccttgaagacgcggaaaccggtcggctgatg
ggggctttcgctcaggaaatggccgacaagaaaggctatacccgggaagagatggacgaa
tacgcgattacctccctgacccgggccaagagagccattgaagaagggctgctgaaagat
gaaatcatcccggttaccgtcaaaacccgcaaaggcgaggtagtggttgaggacgacgag
caaccccacaacgccaacatcgaaaagatcccgagcctgcgcccggcctttgccaaagac
ggcacggtcaccgcggccaatgcctcgtcaatatcggatggagcctctgcactggtgttg
atgcgtgaatccgaagccgaaaagcgcggccttaaacccttggcacggattgttgcccat
agcacccagtcccagcatccgtcggaattcacctgtgctccggtgggtgccatcgaaacc
cttttcgccaaaaccggctggacaaaagacgacgtggacctgtttgagatcaacgaagcc
ttcgccatggtggcgatgatgcccatccgcgaactcggcctggagccggagaaggttaat
atccacggcggcgcctgcgcccagggccatccggttggctccaccggctcccgcctgctg
gtgacgctgatgcactcactcaagcactacggcaagaagaagggcgttgcagcactgtgt
attggtggtggcgaagcaacggcgatggctattgaattgctgtga

DBGET integrated database retrieval system