KEGG   Marinobacter salarius: AU15_12400Help
Entry
AU15_12400        CDS       T03593                                 

Definition
(GenBank) hypothetical protein
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
msr  Marinobacter salarius
Pathway
msr00730  Thiamine metabolism
msr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:msr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    AU15_12400
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:msr03000]
    AU15_12400
Enzymes [BR:msr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     AU15_12400
Transcription factors [BR:msr03000]
 Prokaryotic type
  Other transcription factors
   Others
    AU15_12400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4 Matrilin_ccoil
Motif
Other DBs
NCBI-ProteinID: AHI31786
UniProt: W5YRM8
Position
complement(2557630..2558298)
Genome map
AA seq 222 aa AA seqDB search
MTYQFEDLRKACRTEWRDYIEHSFVKQLGDASLAPEAFQHYLKQDYLFLIQFARAFALAA
YKSPTLLDLRHAKEGLQAIVDVELDLHISYCKEWGISEAELANLPEARATLAYTRYVLDT
GNRGDLLDLHVALSPCMVGYGEIANWLNNRAETIRGDKNPYDAWIAMYESDEFQQAMHAE
IQWLDERLADVSPARFEQLTRIFSDATRLEIDFWEMGLKQSD
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgacgtatcagttcgaagacctaaggaaggcttgccggacagaatggcgcgactacatt
gaacacagtttcgtaaagcagttaggcgatgcgtcgctcgctcccgaagcgtttcagcac
tacctcaagcaggattacctgttcctgatccagtttgcccgcgccttcgccctggcggcc
tacaaaagcccaaccttgctggatctccgccatgcaaaggaaggcttgcaggccatcgtg
gatgtagagctggacctacacatcagctactgcaaggaatggggcatttcagaagcagaa
cttgccaacctgccggaagcgcgcgccacccttgcctacacacgctatgtgctcgacacg
ggcaaccgcggcgatttgctcgacctgcatgttgcgctctccccctgcatggtgggttac
ggggaaatcgccaattggctgaacaaccgggcagaaaccattcggggagacaaaaacccg
tatgacgcctggatcgccatgtatgaaagcgacgagttccagcaggccatgcacgcggaa
atccagtggctggatgaacgactggcggatgtatcccccgccaggttcgagcagcttacc
cggatattcagcgacgccacccggctggaaatcgatttctgggaaatgggtctgaaacag
agcgattga

DBGET integrated database retrieval system