KEGG   Marinobacter salarius: AU15_17860Help
Entry
AU15_17860        CDS       T03593                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
msr  Marinobacter salarius
Pathway
msr00670  One carbon pool by folate
msr01100  Metabolic pathways
msr01120  Microbial metabolism in diverse environments
msr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:msr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AU15_17860
Enzymes [BR:msr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     AU15_17860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AHI32424
UniProt: W5YUA8
Position
3702365..3704101
Genome map
AA seq 578 aa AA seqDB search
MSLQYSKLTPATPPEADFPPPGTPDIEIARSVQPQSILLLAQQRFGLPGESLVPFGHYKA
KLDMAYVDTSDSAPRGKLVLVTAITPTPAGEGKTTTSVGLNDGFNRLGVRSSVCLREPSL
GPCFGMKGGAAGGGRAQVIPMEDINLHFNGDFHAITTAHNLLASLIDNHIHWGNETGLDS
RYVSWRRVMDLTDRSLRNLVCGLGGAAHGVPRETGFDITVSSEIMAILCLADGRADLKQR
LGNIIIGRRSDMTPVTVRDLGVEGALTVLLKEALQPNLVQSLEHNPVFIHGGPFANIAHG
CNSVTATRAALALNDVVVTEAGFGADLGAEKFIDIKCRHTGLRPDAAVVVCTIRALKMQG
GVSRSQLSVPDLAALRAGAANLERHVRNLQQFGLTPVVCINRFPDDTEEEMSLVQSISES
LGVRAVPADHWALGGEGATELAQAVLDQMDEGTPEVNFLYEDSLPLADKIRTIATRIYHA
GSVEFTTVAKRQLEEYESLGFGHLPVCIAKTQYSFSADSSVKGAPSGHMLPVREVRLAAG
AGFVVAVCGDIMTMPGLPRHPAALDIALDENGLVVGLT
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgagccttcagtacagtaagctgacacctgcaacaccaccggaagccgactttccgccg
ccggggactcctgacattgagattgctcgctcggtccaacctcagtctattctgctgctg
gcccaacagcgattcggtctgccgggggagagcctggtgccgttcggccactacaaggcc
aaactggatatggcctatgtggatacctctgatagtgcaccccggggcaaactggtgctt
gtgaccgccattacgcccacgccagcgggggagggcaagaccaccacgagtgtggggcta
aacgacggcttcaaccgcctgggcgtgcgttcgtccgtgtgcctgcgggagccctccctg
ggaccctgtttcggcatgaaaggaggcgcagccggcggcggccgcgcgcaggtgattccg
atggaagacatcaatctgcatttcaatggtgacttccacgccatcaccacggcccacaat
ctgctggcgtcattgatcgacaaccacatccactggggtaatgagacgggcctggactct
cgctatgtgagctggcggagagtgatggacctgaccgaccgttccctgcgcaacctggtg
tgtgggcttggtggtgcggcccacggcgtgccccgggaaaccgggttcgatattacggtg
tcgtctgagatcatggcgatcctgtgcctggcggacggtcgggcggacctcaagcagcgg
ctgggcaatatcattatcggcaggcgctctgatatgaccccggtgaccgttcgcgacctg
ggcgttgaaggggcgctgactgtgcttctgaaagaggcactgcagcccaatctggtccag
agcctggaacacaacccggtgttcatccacggtgggccgtttgccaatatcgcccacggc
tgtaattccgtgaccgctacccgtgcggctctggccctgaacgatgtggtggtcaccgag
gcgggatttggcgccgacctgggggcggaaaagttcattgatatcaaatgcaggcacaca
ggcctgcggccagacgccgccgtggtggtctgtaccattcgggcgctcaaaatgcagggc
ggggtctctcgcagccagctctccgttcccgacctcgccgccttgagggccggtgctgcc
aacctggagcggcacgtccgtaatctgcagcagttcgggctgacgccagtggtgtgcatc
aaccgtttcccggacgataccgaggaggaaatgtcactggtgcaatccatcagtgagtcg
ctgggtgtgcgtgcagtgcctgccgaccattgggccctgggtggtgagggtgccaccgaa
ctggcccaggcagtgcttgatcagatggacgaaggcacaccggaggtgaactttctctat
gaagacagcctgccgctggcggataaaatccgcaccatcgccacgcgcatttaccacgcc
ggtagcgtggaattcaccacggtggcgaagcggcagctggaggaatacgaaagcctgggg
tttggccacctgccagtatgtattgccaagactcagtacagcttttcggcggactcgtcg
gtgaagggagcgccgtccggccatatgcttccggtaagggaagtgcgcctggcggccggc
gccggctttgtggtggcggtgtgtggtgacattatgaccatgcccggtttgccacgccat
cccgcggcactggacattgctctggatgaaaacggcctggtggtggggttaacctga

DBGET integrated database retrieval system