KEGG   Methanosphaera stadtmanae: Msp_0263Help
Entry
Msp_0263          CDS       T00313                                 

Definition
(GenBank) predicted phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mst  Methanosphaera stadtmanae
Pathway
mst00010  Glycolysis / Gluconeogenesis
mst00030  Pentose phosphate pathway
mst00051  Fructose and mannose metabolism
mst00052  Galactose metabolism
mst00230  Purine metabolism
mst00500  Starch and sucrose metabolism
mst00520  Amino sugar and nucleotide sugar metabolism
mst00521  Streptomycin biosynthesis
mst01100  Metabolic pathways
mst01110  Biosynthesis of secondary metabolites
mst01120  Microbial metabolism in diverse environments
mst01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msp_0263
   00030 Pentose phosphate pathway
    Msp_0263
   00051 Fructose and mannose metabolism
    Msp_0263
   00052 Galactose metabolism
    Msp_0263
   00500 Starch and sucrose metabolism
    Msp_0263
   00520 Amino sugar and nucleotide sugar metabolism
    Msp_0263
  Nucleotide metabolism
   00230 Purine metabolism
    Msp_0263
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Msp_0263
Enzymes [BR:mst01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Msp_0263
    5.4.2.8  phosphomannomutase
     Msp_0263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABC56679
UniProt: Q2NHF4
Position
328052..329395
Genome map
AA seq 447 aa AA seqDB search
MKQLFGTFGVRRVANTVLTPEFASKIAAAYGTKVKGTIAIGSDPRTSSEMIKHAVTAGLL
SVGCDVVDLGTLPTPAVQYAVRQYYDGGIMVTASHNPPKYNGLKLLDSDGIGTPDDLEEE
IEDIYFNDKQERVTWDKIGKAYKRDIIDEYIDEVLKRVDVDTIKQANLKVILDAGSGAAC
STTPYIIRKLGCDITTLNCQPDGAFPGRNPEPTEDNLQDLIKVVKATGADIGIAHDGDAD
RTICIDEKGQFVFGDKSFALVEKSMLEKNNGGKIVTTVATSNAIADIALENNGEIILTKV
GDLVVARKLQEVDGLFGGEENGGLIFPDFVYGRDSGLATAMLLEIIAKTKQPLSQLISQL
PTYFSEKRKVECPDDKKATVAENIIKDTTEYEVDTTDGVKVITSDGWVIIRPSGTEPIYR
CFSEAKTPEKATELADWGMNLIKKYLD
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaattatttgggacatttggtgtacgaagagtagcaaacacagttttaactcca
gaatttgcatcaaaaattgcagcagcttatggaacaaaagttaaaggaacaatagcaata
ggatcagatccaagaacatcctctgaaatgataaaacacgccgttacagcaggattatta
tcagtaggatgtgatgtggttgatttaggaacactaccaacacctgcagtacagtatgca
gtaagacaatactatgatggtggaatcatggttacagcttcacataatcctccaaaatat
aatggattaaaattattggactctgatggtattggaactcctgatgatttggaagaagaa
attgaagatatttactttaatgataaacaagaacgtgtaacttgggataaaattggaaaa
gcatataaaagagatattattgatgaatacatagatgaagtgctaaaaagagtagatgta
gacacaataaaacaagcaaatctaaaagtaattctagatgcaggatctggagctgcatgt
tcaacaacaccatacattataagaaaattgggatgtgacataacaacacttaattgtcaa
ccagatggagcattccctggacgtaatccagaaccaacagaagataatctacaagatctt
ataaaagtagttaaggcaactggtgcagatattggaattgcacatgatggtgatgcagat
agaacaatatgtattgatgaaaaaggacaatttgtttttggagataaatcatttgcactt
gttgaaaaatctatgcttgagaagaacaatggtggaaaaatagtaactacagttgcaaca
agtaatgcaatagcagatatagcacttgaaaataatggtgaaataattctaacaaaagta
ggagatcttgtagttgcacgtaaattacaggaagtagatggtttatttggtggagaagaa
aatggtggattaatattccctgactttgtatatggaagagattctggactagctacagca
atgcttcttgaaataatagctaaaacaaaacaaccactatcccaattaattagtcaatta
ccaacatacttctcagaaaaaagaaaagttgaatgtcctgatgataaaaaagctacagtt
gcagaaaatataattaaagacacaacagaatatgaagttgacacaacagatggtgttaaa
gtaataacaagtgatggatgggtaataataagaccatctggtacagaaccaatatataga
tgcttctcagaagcaaaaactcctgaaaaagcaacagaattagctgattggggaatgaat
ttaattaagaaatatttagattaa

DBGET integrated database retrieval system