KEGG   Methanosphaera stadtmanae: Msp_0303Help
Entry
Msp_0303          CDS       T00313                                 

Gene name
mtrB
Definition
(GenBank) MtrB
  KO
K00578  tetrahydromethanopterin S-methyltransferase subunit B [EC:2.1.1.86]
Organism
mst  Methanosphaera stadtmanae
Pathway
mst00680  Methane metabolism
mst01100  Metabolic pathways
mst01120  Microbial metabolism in diverse environments
mst01200  Carbon metabolism
Module
mst_M00567  Methanogenesis, CO2 => methane
mst_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mst00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Msp_0303 (mtrB)
Enzymes [BR:mst01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Msp_0303 (mtrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrB
Motif
Other DBs
NCBI-ProteinID: ABC56713
UniProt: Q2NI30
Position
363476..363769
Genome map
AA seq 97 aa AA seqDB search
MVDTTAVIIDDDLVLDVNNGIIGTKDNNQKQHLPFDDLVEKIDTLEVAINNLESSLDPRT
TSNLSQPGREGIYEKAGLITNIVIGVIIALVFILLLV
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
ttggtagatacaacagcagttataattgatgatgatttagttttagatgttaataatggt
ataataggaacaaaagataataatcaaaaacaacatcttccatttgatgatctggtagaa
aaaatagatactctggaagtggcaattaataatctagaatcatcattagatcctagaaca
acatctaatctatcacaacctggaagagaaggaatatatgaaaaagcaggattaattaca
aacattgtaattggtgtgattatagcattagttttcatacttttattagtataa

DBGET integrated database retrieval system