KEGG   Methanosphaera stadtmanae: Msp_0336Help
Entry
Msp_0336          CDS       T00313                                 

Gene name
porA
Definition
(GenBank) PorA
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mst  Methanosphaera stadtmanae
Pathway
mst00010  Glycolysis / Gluconeogenesis
mst00020  Citrate cycle (TCA cycle)
mst00620  Pyruvate metabolism
mst00640  Propanoate metabolism
mst00650  Butanoate metabolism
mst00680  Methane metabolism
mst00720  Carbon fixation pathways in prokaryotes
mst01100  Metabolic pathways
mst01120  Microbial metabolism in diverse environments
mst01130  Biosynthesis of antibiotics
mst01200  Carbon metabolism
Module
mst_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mst_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Msp_0336 (porA)
   00020 Citrate cycle (TCA cycle)
    Msp_0336 (porA)
   00620 Pyruvate metabolism
    Msp_0336 (porA)
   00640 Propanoate metabolism
    Msp_0336 (porA)
   00650 Butanoate metabolism
    Msp_0336 (porA)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Msp_0336 (porA)
   00680 Methane metabolism
    Msp_0336 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Msp_0336 (porA)
Enzymes [BR:mst01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Msp_0336 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: ABC56746
UniProt: Q2NHW9
Position
397108..398247
Genome map
AA seq 379 aa AA seqDB search
MVKKVISSAEAVSEAVKRARPSVIPVYPITPQTKISEKLADYVADGDLDAHYIKVESEHS
AMSAAIGASGAGVRVFTATSSQGLAYMHEPVFAAAGMRVPIVMANANRALSAPINIWNDQ
QDSISERDSGWIQLYAETGQEAFDTILQAYKISENQDILLPTMVCIDGFILTHTVDPVEV
LSQEEVDSFLPKYTRGYSYLDPEDPMSLGTLADTESYLEIRHDMEIAMEHSLDVIEEVGK
EFGDLFGRYYGLIEEYKSEDADIILIAMGSLCGTIKDVVDKERENGKKVGLVRIRSYRPF
PKDALKVAVKDAKLAVIDKDISFGAGGAVYMDVKAALDNETYGFIIGLGGRDITPIDIEE
IIEKTENPTKDIEWIGLRE
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atggttaaaaaagttatatcatctgcagaagcagtatctgaagcagtaaaacgtgcaaga
cctagtgttatacctgtatatccaattacaccacaaacaaaaatatctgaaaaattagca
gattatgttgctgatggtgatttggatgctcattatataaaagtagaatcagaacacagt
gcaatgagtgcagcaataggtgcatcaggagctggtgtaagagtatttacagctacatca
agtcaaggattagcatatatgcatgaaccagtatttgcagcagctggtatgagagtacca
atagtaatggctaatgcaaatcgtgcattatcagcacctattaacatatggaatgatcaa
caagattcaatatctgaaagagatagtggatggatacagttatatgcagaaactggtcaa
gaggcatttgatacaatattacaagcatataaaatatctgaaaatcaggatatcttatta
cctacaatggtatgtatagatggatttatattaacacacactgtagatcctgttgaagta
ttatcacaagaagaagtagattcattcctaccaaaatatacaagaggatattcatatctt
gacccagaagatccaatgtctttaggaacattagcagatacagaatcatacctagaaatt
agacatgacatggaaatagctatggaacactcattagatgttattgaagaagtaggtaaa
gaatttggtgacttatttggaagatactatggtcttattgaagaatataaatctgaagat
gcagacataatcctaatagcaatgggttcactttgtggaacaataaaagatgttgttgac
aaagaaagagaaaatggtaaaaaagtaggattagtaagaataagatcatacagaccattc
ccaaaagatgctttaaaagtagcagttaaagatgcaaaattagctgttattgataaagat
atatcctttggtgcaggtggagctgtatatatggatgtaaaagcagcacttgataatgaa
acatatggtttcataataggtctaggtggaagagacataactccaatagatatagaagaa
atcattgaaaaaaccgaaaatccaacaaaagatatagaatggataggattaagggagtag

DBGET integrated database retrieval system